KEGG   Physcomitrella patens subsp. patens: 112294753Help
Entry
112294753         CDS       T01041                                 

Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 12-like isoform X1
Organism
ppp  Physcomitrella patens subsp. patens
SSDB OrthologParalogGFIT
Motif
Pfam: CDI DUF3037 AHD
Motif
Other DBs
NCBI-GeneID: 112294753
NCBI-ProteinID: XP_024401313
LinkDB All DBs
Position
17
AA seq 326 aa AA seqDB search
MMNVTQNEMDTGAIAIKEYLEDGRIEKVIQEQRVVAIQEKRLDAAIEELLKLETELRSTS
DARRIQRVVVSILQLCYEAQAWKTLIKQIRFFSQCPDQLKQAVIAMVNQAVSYLNDIHDP
EIRIELEETLNHVSSSKGLQNLCRYSLSTPLEGLAGDRKSRLADLNMSALKLSCESREER
GQAKVEERGQAKVEERGQELTTPDHESLPTTPPHKHIKEKDSAPSLCRAPRKKKTYLVRK
PVGAVRRRLFGQVPPADVEDFLSELEQSTQQRFIDRYNFDPVKEKPLPGRFEWSPLRLRE
PHYTRPTSKDSSTDIQRSELAPLLSA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgtcactcaaaatgagatggacacaggagccattgcaattaaagaatatctc
gaagatggcagaattgagaaggttattcaggagcaacgagtcgtcgctattcaggaaaag
agactagatgcggctattgaagaactgttgaagttggaaaccgaactgcgaagtacctct
gatgctcgaaggatccaaagagtggtggtttctattcttcaactgtgttacgaggcacag
gcttggaagacgcttattaaacagattcggtttttttctcagtgtccggaccaattaaag
caggctgttatcgccatggtcaatcaagcagtgtcatacttaaacgatatacatgatccc
gaaatcaggatcgagctcgaagagactctcaaccatgtctcgtctagcaaaggtctgcag
aatttgtgtcggtattcgctatcgactccgctcgagggtttggctggtgatcgtaagtct
cgactggcagacttgaatatgtcggcgcttaagttgtcttgtgagagccgtgaggagcgg
ggccaagccaaggttgaggagcggggccaagccaaggttgaggaacgaggtcaggagctt
acaactcctgatcatgaaagtctaccaaccaccccacctcacaagcatatcaaagaaaag
gactccgccccgtcattatgcagagctccccgtaagaaaaaaacctaccttgtaaggaag
cccgtaggtgcagtgcgtcgacgcttgtttggtcaagtaccccccgctgatgtagaggat
ttcctatctgagttggagcaaagcacccaacagcgatttatagacaggtacaacttcgac
cctgtgaaagagaaacctcttcctggtcggtttgagtggtcccctttacggctacgggag
ccacattatacgagacccacaagcaaggattccagtactgacatacagaggtcagagttg
gcccctttattgtcagcataa

DBGET integrated database retrieval system