KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_004460Help
Entry
PPSQR21_004460    CDS       T03178                                 

Gene name
lytS
Definition
(GenBank) sensor protein
Organism
ppq  Paenibacillus polymyxa SQR-21
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase HisKA 7TMR-DISM_7TM HATPase_c_2 HATPase_c_3 OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AHM64130
LinkDB All DBs
Position
503066..506206
Genome map
AA seq 1046 aa AA seqDB search
MKKQGVLFFIILLLAVALPVYPLVSGVLSGNSHWKAHNGVIDLRNWDPDKEGAVQLGGEW
EFYPNQLLQPSSFQETRDQDWGNRRNSSKLGSGTGSSAKIVDVPGRWNQWMPGGQATGYG
TYHVRVLLPEKLENLYGIHMQNIRNSSRVWIDGAEVGASGIPSVSAEKGKQGNAPFVGFA
AIDGHATDIIVHVANYSYSSGGIIYPLLFGDYASITHSREVAMAEDTVLVAGFFIPTVFF
IMLYLLRKKEKALLYLACFCIAALFYILTHGEKLLVWGMPDLPYEWILKIQSFSSTLFYY
FLIRYVHLSTQIVMNRIVLRLYSITTALMLGMGLLLPTLVLSSFETFILLFGVVSVGYVL
LILIRGLVQRTDDAALLVISIMSILMIVVTNFVYVLGWGDVRGVTAYEMLIFVLAQTLLL
AKRFVYSFMEVENLSRRLLTLDGLKDEFLANTSHELRTPLHGIINIAQSMLDRYGTQFNE
PQKHNLVLIANVGRRLSYLINDILDFSNLKNGRLALNRRPVNVQAAVNSVLEVLGHSVGK
KKLQFVKEWPNSLPKVDADEHRLNQILYNLLGNAMKFTEEGKIVISAKTRNREMEISVKD
TGPGIAPDHLLHIFEPFNRGANAEDEGYSGTGLGLGITRRLVELHGGHIRVESRLGKGST
FYFTLPLAETGTSAHEAQKNVLSEVILQPGVTSSQDVNPLEEDGLEQVRNVPYRVLAVDD
DEVNLRVLKELLYTTGCSVVAVEHAEEALQLLNSRTRFDLVITDWMMPEMSGIELCRRIR
ERYSLSELPVLLLTARDLPGDIRAGFMAGANDFLRKPVDAEELKARVRTLLNMRHSAEEA
VRSEMAFLQAQIKPHFLYNALNVIVSTVAVDPDKAAELLMELSQYLRGSFDFQNRENTVP
LCKELELVESYVALEKARFEERLQVTIEVGRNIRSLIPPLSIQPIVENAIRHGVMQRATG
GTVRVIVQEAGADFVVSVTDDGVGIPPERLRHLLSEEHVSSSVGLRNIHRRLIHMYGEGL
QIESNPMQGTTVSFRVPEMTLSRPSE
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagggtgttttattttttattatacttctgcttgcggttgcgttgccggtg
tatccgttagtgtcgggcgtattatccggaaacagtcattggaaagctcacaacggtgtt
attgatttgcgtaattgggaccccgacaaggaaggcgctgtacagttgggaggagagtgg
gagttttatcctaatcagcttttgcagccttcatcgtttcaggaaacgcgagatcaggat
tggggaaatcgtcgaaactcctccaaattgggatcaggcaccggatcttccgccaaaatt
gtggatgtgcctggtagatggaatcagtggatgcctgggggacaggcgactggatatggt
acctaccatgttcgtgtacttttacctgaaaaattggaaaatctgtacggcatccatatg
caaaacattcgcaactctagccgagtatggattgatggagcagaggtgggggcaagcggt
attccctctgtttcggccgaaaaaggcaaacagggcaacgccccctttgttggatttgct
gcaatagatggacatgcgactgatattatcgtgcatgtggctaattatagctattcctcc
gggggaatcatttatccgctgctgtttggtgattatgccagtattacgcatagccgggaa
gtagcgatggcagaggacaccgtactggtcgcaggattttttatccctactgtatttttt
atcatgctgtaccttttgcgtaaaaaagagaaggccctgctttatttagcatgcttttgt
atcgcggcattattttacattctgacacatggagagaagctgctagtctggggcatgccg
gatttaccttatgaatggatattgaaaattcaatcgttctcttcaacgctgttctattat
tttttaatcaggtatgttcatctttcaacgcagattgttatgaatcgaatcgtgctgcgt
ctctatagtattacaactgcactgatgctgggtatggggctattgttacctacactggta
ctctcatcctttgaaacgtttatccttctttttggtgtagtcagtgtgggatatgtatta
ctgatcctaattcgtggacttgttcaacgtacggacgatgctgcactgctagtcattagt
attatgagcattcttatgattgtggtgaccaattttgtgtatgttctgggatggggagat
gtacgtggggtgacagcctatgaaatgctcatattcgtattggctcaaacactgttgctg
gccaaacgttttgtatattcgttcatggaggtagagaacctatcacgacggttgctaacc
ctggatgggttaaaggacgaatttctggcgaacacgtcacatgagctgcgcactcctcta
catggaattattaatattgctcaatccatgctagaccgctatgggacacaattcaatgag
ccgcaaaagcacaatttggtcttgattgcgaatgtagggcgcaggctttcctatttgatt
aacgatattttggatttttctaatttgaaaaatggaagattagccttaaaccgccggcct
gtaaacgtacaagctgcagtgaactctgtgcttgaggtattgggtcattcggtaggtaag
aaaaagctccaattcgtcaaagaatggcctaattcgttgcctaaggtggatgcagatgaa
catcgcctgaatcagatcttatacaatttattggggaatgcgatgaagtttacggaggaa
ggcaaaatcgtaatctctgccaagaccaggaaccgcgaaatggaaattagtgtgaaggat
accggaccaggtattgccccagaccatcttttgcacatctttgaaccttttaaccgaggg
gcgaatgctgaggacgaaggatatagtggaactgggcttgggttaggcataacccgtcgt
ctggtggagctgcatggaggccatatccgagtagagtccagattgggtaaaggttcgacc
ttttattttacactgcccttagcggagactggtacgtcggcacatgaagctcaaaaaaat
gttttgtctgaggttatattgcagcctggtgtgacctcgagtcaggatgtgaatccgctt
gaagaagatggattggagcaagtgaggaatgttccttacagagtgctggctgtagatgat
gatgaagttaaccttcgggtgttgaaggagctgttatacaccacaggttgtagtgtggtg
gctgtggaacatgctgaggaggcgcttcagctgctgaatagccgtacccgatttgaccta
gtcattacggactggatgatgccagaaatgtccggtattgagctgtgccgacggattcgc
gaacggtattctctctccgaactacccgtgttgctgctgacggcacgcgatctgcccggc
gatatccgtgcaggcttcatggctggagccaatgactttctacgtaagcctgttgatgct
gaggaattaaaggcgcgtgtgcgcaccctgctgaacatgcgccattcggcagaggaagcg
gtgcgttcggaaatggcctttttacaggcacaaatcaagccgcactttctgtacaatgca
ttaaatgtcattgtttcgaccgtagcggtagacccggacaaagcagcggagctgcttatg
gagctgagccagtatttgcggggaagctttgattttcagaacagggagaatacagttccg
ctatgcaaggagctggaattggtagaatcgtatgtggcattggaaaaagcccgatttgaa
gaacgtttgcaggtgactatagaggtagggaggaacatccggtcgctgatcccgccatta
agcattcagcccattgtggaaaatgcaatacgacatggtgtaatgcagcgggccacaggt
ggaacggtgcgggtgattgtacaagaggctggagccgattttgtggtcagcgtgaccgat
gacggcgtagggattccgccagagcgactgcgacacttactgtcggaggagcatgtatcc
tccagtgtggggctgcgtaatatccatcgccgtctgattcatatgtatggagaaggattg
cagattgaaagcaatcctatgcaagggacgacggtaagcttccgtgtgccggaaatgacc
ttatctcgccctagtgaatga

DBGET integrated database retrieval system