KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_007750Help
Entry
PPSQR21_007750    CDS       T03178                                 

Gene name
ddlA
Definition
(GenBank) d-alanine--d-alanine ligase b
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00473  D-Alanine metabolism
ppq00550  Peptidoglycan biosynthesis
ppq01100  Metabolic pathways
ppq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PPSQR21_007750 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PPSQR21_007750 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PPSQR21_007750 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppq01011]
    PPSQR21_007750 (ddlA)
Enzymes [BR:ppq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PPSQR21_007750 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ppq01011]
 Precursor biosynthesis
  Amino acid ligase
   PPSQR21_007750 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHM64438
LinkDB All DBs
Position
856671..857759
Genome map
AA seq 362 aa AA seqDB search
MANQKLTVGLVYGGKSGEHEVSLQTAYAVMNAFNYEKYEIIPFYITKAGDWRRGTLLSAP
LTTVDQLKLEHAEGGTKAALDTLFGKLYGEQTLDVLFPLLHGTFGEDGTIQGLFEMADMP
YVGAGVLASAAGMDKGVMKKLFEHAGLPQVKYCYFNSTQWAQTGHDLVRNIETELGYPCF
VKPANLGSSVGISKASNREELEKAVDLALQFDLKVIVEEYVDAREIEVSVLGNDEPIASV
PGEIVSSSDYYDYAAKYTDGQSEMLIPAPLDEEVADRIREAALQAFRALEGCGISRADFF
VRRSDGHILINEVNTMPGFTPFSMYPLLWRETGVSYASLLDRMIALALERYERRSALHYE
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcaaaaattgaccgtagggctggtgtacggtggtaaatcgggcgaacatgag
gtatcgctgcaaacggcgtatgcggtaatgaacgcttttaactatgagaaatacgagatt
attcctttttatattacgaaggctggcgattggcgtagagggacgctgttaagtgcgcct
ttgactactgtagaccaattgaagctggagcacgctgagggcggcaccaaggcggcatta
gatacgttgttcggcaagttgtatggagagcagacgctggatgtactgtttccgctgctg
cacggcacctttggcgaagatggaacgattcagggtctgttcgaaatggctgatatgccc
tatgtcggggcaggcgtgctggcttcggcagcaggtatggataaaggcgtcatgaagaag
ctgtttgagcatgcaggattgccgcaagtgaaatactgctattttaatagtacacagtgg
gcacaaaccggtcatgacttggtgcgtaacatagagactgagttgggttatccttgcttt
gtcaaaccagccaatctgggatcgagtgttggtatttccaaagcgagtaaccgagaagaa
ctggaaaaggctgtagatctggctctgcaatttgacctgaaggtgattgtggaggagtac
gtcgatgcccgtgagattgaagtcagcgtacttggcaatgacgagccgattgcctcggta
ccgggtgaaattgtgtcgtcgagtgattactacgactatgctgccaaatataccgatggt
caatcggaaatgctcattccggcaccactggacgaggaagtggcagatcgtatccgtgaa
gccgcattgcaagctttccgtgctctggaaggttgcgggatttcccgtgccgatttcttc
gtcagacgctcagatggacatatccttattaatgaagtgaatacaatgcctggctttaca
ccgttcagcatgtatccattattgtggagagaaaccggcgtatcctatgcaagcctgctg
gatcgcatgattgctcttgcactggagcgttatgagcgcaggtcggcactgcactatgag
aactcataa

DBGET integrated database retrieval system