KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_012830Help
Entry
PPSQR21_012830    CDS       T03178                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00473  D-Alanine metabolism
ppq01100  Metabolic pathways
ppq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PPSQR21_012830 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PPSQR21_012830 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppq01011]
    PPSQR21_012830 (alr)
Enzymes [BR:ppq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PPSQR21_012830 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ppq01011]
 Precursor biosynthesis
  Racemase
   PPSQR21_012830 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AHM64943
LinkDB All DBs
Position
1501558..1502754
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKALPADKLMLVCVKANAYGHGAVEISKEMERLGAD
YLSVAFLDEALELRHAGVGLPILVLGYTSPEAVQTAWEHDISLTVFSEEVLEGIRRLDRQ
GSERKLKVHIKIDSGMGRLGLLPGEAALAFVRQVHELEQVLLEGMYTHFARADEEDKSYT
LLQYDRFRGVADALREQGISIPIIHTGNSAATIDTPSLSPNMVRIGISIYGLYPSDEVNR
QVIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSDEERIGTLPIGYADGYSRMLSGKV
EVLIRGRRVPVLGTICMDQCMVSLQSFAEDAEEIQTGEEVVLIGQQSGEIIAADELASKL
GTIHYEVICMIADRVPRVYMRDHVPVVRVNSLLPTRWN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaggcctttcgcaaggcattgcctgcggataagctgatgctggtctgtgtcaaggct
aatgcctacggtcacggtgccgtagaaatttcaaaggaaatggaacgccttggtgcggat
tatttgagcgtcgcttttctggatgaggctctggagcttcgtcatgcgggggttggactg
ccgatccttgtactcggctatacctcacctgaagctgtccaaacagcttgggagcatgat
atctcattgactgtgtttagtgaggaagtgctggagggtatccgcagattggaccgccaa
ggaagcgaacgcaagctgaaggtgcacatcaaaatagacagcggtatgggaagactcggt
ttgctgcctggagaagcagctttggcttttgtccggcaggttcacgaattagagcaggtg
ctgctggaaggcatgtacacccattttgcccgtgcggatgaagaagataaaagctataca
ctgctacaatatgatcggtttcggggcgtggcggatgcgctaagggaacaaggtatttct
attcccattatacatacgggcaacagcgcggccaccattgataccccttccctttccccc
aatatggtgcggattggcatcagtatttacggtctgtatccgtctgatgaggttaaccgg
caagtcattgaactgttgcctgtattgtcattaaagacggcggtggtttataccaagacg
cttcctcccggctggggggttagctacggcacccggtatgtgacctctgatgaagagcgg
atcggcacactgccaattggttatgcggatggatactcccgcatgctaagtgggaaggtc
gaagtgttgatacgcggtcgtcgcgtccctgtactcggtacgatttgcatggaccagtgt
atggtatccttacaatctttcgcagaggatgcggaagaaatccaaaccggcgaagaggtt
gttctcatcggccagcagtccggcgaaatcattgcggcggatgagctggcatccaagctt
ggtacaatccactacgaggtgatctgcatgatcgcagacagggtaccgcgtgtttacatg
cgagatcatgttcctgtcgttcgggtgaactcgcttcttccaacccgctggaattaa

DBGET integrated database retrieval system