KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_016750Help
Entry
PPSQR21_016750    CDS       T03178                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00020  Citrate cycle (TCA cycle)
ppq00480  Glutathione metabolism
ppq01100  Metabolic pathways
ppq01110  Biosynthesis of secondary metabolites
ppq01120  Microbial metabolism in diverse environments
ppq01130  Biosynthesis of antibiotics
ppq01200  Carbon metabolism
ppq01210  2-Oxocarboxylic acid metabolism
ppq01230  Biosynthesis of amino acids
Module
ppq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPSQR21_016750 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPSQR21_016750 (icd)
Enzymes [BR:ppq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PPSQR21_016750 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHM65327
LinkDB All DBs
Position
1899906..1901201
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GTKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFADKVFTWAQYDVIKEKEGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWKEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacaattgataac
ggtcaactgcaggttccaaatcatccggtaattccgtttatcgagggtgacggcacaggt
cgcgacatctggaaagcttccaagcgcgtactggacgcggctgtagaaaaagcatataac
ggcacgaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgagtggctccctaacgatactttggaagccatccgtgagtatattgtagccattaaa
ggtccacttacgacacctattggcggtggtatccgttcattgaatgtggcattgcgccaa
gaactggacttatacgtatgcctgcgtcctgttcgctactttaacggtgtcccatctcca
gtaaaacgtcctgagttggtagacatggtcattttccgtgagaatacagaagatatttac
gcagggatcgaatatgccgaagggtctgaagacgtgaaaaaggtaattcagttccttcag
caagagctgggcgtgaataaaatccgtttccctgaaacctcaggaattgggattaagcca
gtttcctccgagggttcaaagcgtctggtacgggcagctattcagtatgccgttgaccat
gggcgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgaaggtgcc
ttcaaaaactggggttatgaagtagctgagcaagagtttgcagataaagtatttacttgg
gctcagtatgatgtcatcaaggaaaaagaaggtgaggatgcggcaaatgcagctcaaaaa
gcagctgaagatgcaggcaaaatcattattaaggatgcgattgctgatattgcacttcaa
caagtgctgactcgtccttctgaatttgatgtcattgctacgctgaacctgaacggggac
tatctgtccgatgctttggctgctcaagttggtggaattgggatcgcgccaggtgcaaac
attaactatgtaaccgggcatgctatctttgaagctacgcatggtacagctccaaaatat
gcagacaaagacgtagtgaaccctggttccgtaattctgtccggcgttatgctgcttgaa
catttgggctggaaagaagcagctgacctgatttacaaggggctggagacgtccattaat
aaaaagatcgtaacttatgactttgcccgtctgatggacggtgctacacaggtgaaatgc
tccgagttcgcggacactattattagtaacctgtaa

DBGET integrated database retrieval system