KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_026910Help
Entry
PPSQR21_026910    CDS       T03178                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00010  Glycolysis / Gluconeogenesis
ppq00020  Citrate cycle (TCA cycle)
ppq00620  Pyruvate metabolism
ppq01100  Metabolic pathways
ppq01110  Biosynthesis of secondary metabolites
ppq01120  Microbial metabolism in diverse environments
ppq01130  Biosynthesis of antibiotics
ppq01200  Carbon metabolism
Module
ppq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSQR21_026910
   00020 Citrate cycle (TCA cycle)
    PPSQR21_026910
   00620 Pyruvate metabolism
    PPSQR21_026910
Enzymes [BR:ppq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPSQR21_026910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 ATP-synt_ab_Xtn GCV_H RnfC_N NQRA Transglycosylas
Motif
Other DBs
NCBI-ProteinID: AHM66333
LinkDB All DBs
Position
complement(3116391..3118004)
Genome map
AA seq 537 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIIKMHIKPGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVQEV
FAKDGDIFNVGQVVAVIDAEGELPEQEDAPEAPAASPEPVAAAQGGAAGAARFEYKFPEL
GEGLHEGEIIKMHIKPGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVQEVFAKDGDIFNVG
QVVAVIAAEGELPEQEEAPAAVKQEEDAAKGGANTQPGATPAASNRDVLATPSVRKFARE
QGVNIAQVSGSGKNGKITKEDVEAFKNGGGQAAAPAAKEAAKAQEPAKKEAKAAAPSAPA
ADPRAEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRTRIKPIAEKKGT
KVTYLPFIVKALVAASRQFPALNASIDEEANEIVYKKYYNIGIATDTDNGLIVPVIKDAD
RKSIWMIADSIRDLAVRGRDGKLAANEMRGSTISITNIGSAGGMFFTPIINFPEVAILGT
GRISEKAVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKQLLANPELLVMEV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatttgaatataaattcccggagctgggtgaaggtcttcacgaaggcgaaatc
atcaagatgcacatcaagcccggcgacaaagtaactgatgatgatatcatcatggaagta
caaaacgacaaggctgtagttgaagttccatgtccggttaatggtacggttcaagaagta
tttgccaaagacggagacatctttaacgtaggtcaagttgtagctgtcatcgacgcagaa
ggtgaacttcctgaacaagaagatgcaccggaagcaccagctgctagccctgagccagtt
gctgctgcacaaggcggagctgcaggtgcagctagatttgaatataaattcccagagctg
ggtgaaggtctgcacgaaggtgaaatcatcaagatgcacatcaaacccggcgacaaagta
actgatgatgatatcatcatggaagtacaaaacgacaaggctgtagttgaagttccatgt
ccggttaatggtacggttcaagaagtgtttgccaaagacggagacatctttaacgtaggt
caagttgtggctgtcatcgctgctgagggtgaacttcctgagcaagaagaagcaccagct
gctgttaaacaagaagaggatgctgcaaaaggtggagcgaacactcaaccaggtgcaaca
cctgctgcttcgaacagagacgtgctggctacacctagcgtccgtaaatttgcacgtgag
caaggtgttaacatcgctcaagtgagtggctccggcaaaaacggtaaaatcactaaagaa
gatgtagaagctttcaaaaatggcggaggccaagcggctgcaccagcagcgaaagaagct
gcaaaagcgcaagagccagctaaaaaagaagcgaaagctgcagcaccatccgcaccagct
gcagatccgcgtgctgaggaagaacgcgtaccatttaaaggtatccgtaaagcaatttcc
aatgctatggttaagtcggcttacacggctccacacgttacaattatggatgaagtggat
gtaactgagctggttgctttccgtactcgtatcaagccaattgcagagaagaaaggcaca
aaagtaacttacctgccgttcatcgtaaaagctttggttgctgcttcccgtcaattcccg
gctctgaatgcctcgatcgacgaagaagctaacgaaattgtctacaaaaaatactacaac
atcggtatcgctacagatacagacaacggcttgatcgttcctgttatcaaagatgctgat
cgtaaaagtatctggatgattgctgattccattcgtgatctggctgtacgcggtcgtgat
ggtaaattggctgccaatgaaatgagaggaagcacgatttccatcacgaacattggttcc
gcaggcggtatgttctttactccaatcatcaacttccctgaagttgcaattttgggtact
ggccgcatcagtgaaaaagcagtcgtgaaaaacggtgaaattgttgccgctccagtaatg
gctctttccctgagctttgaccaccgtattattgacggtgcaactgctcaaaacttcatg
aactatatcaaacagctgctcgctaaccctgagctgcttgtaatggaggtgtaa

DBGET integrated database retrieval system