KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_040810Help
Entry
PPSQR21_040810    CDS       T03178                                 

Gene name
lasB
Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
ppq  Paenibacillus polymyxa SQR-21
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ppq01002]
    PPSQR21_040810 (lasB)
Enzymes [BR:ppq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PPSQR21_040810 (lasB)
Peptidases [BR:ppq01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PPSQR21_040810 (lasB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP
Motif
Other DBs
NCBI-ProteinID: AHM67703
LinkDB All DBs
Structure
PDB: 

Position
4630721..4632499
Genome map
AA seq 592 aa AA seqDB search
MKKVWFSLLGGAMLLGSVASGASAESSVSGPAQLTPTFHAEQWKAPSSVSGDDIVWSYLN
RQKKSLLGVDSSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVT
SYLGAVINEDQQEEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDAEEPSSV
SKDTYAEAANNDKTLSVDKDELSLDKASVLKDSKIEAVEAEKSSIAKIANLQPEVDPKAE
LYYYPKGDDLLLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDIINEATGTGKGVLGDS
KSFTTTASGSSYQLKDTTRGNGIVTYTASNRQSIPGTLLTDADNVWNDPAGVDAHAYAAK
TYDYYKSKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDV
VGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRS
MSNPTLYDQPDHYSNLYKGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAV
QIYYSAFTNYLTSSSDFSNARAAVIQAAKDLYGANSAEATAAAKSFDAVGVN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatggttttcgcttcttggaggagctatgttattagggtctgtggcgtct
ggtgcatctgcggagagttccgtttcgggaccagcacagcttacaccgaccttccacgcc
gagcaatggaaagctccttcctcggtatcaggggacgatattgtatggagctatttgaat
cgacaaaagaaatcgttactgggtgtggatagctccagtgtacgtgaacaattccgaatc
gttgatcgcacaagcgacaagtccggtgtgagccattatcgactgaagcagtatgtaaac
gggattcccgtatatggagctgagcaaactattcatgtgggcaaatctggtgaagtcacc
tcttacttaggagcggtgattaatgaggatcagcaggaagaagctacgcaaggtacaact
ccaaaaatcagcgcttctgaagcggtctacaccgcatataaagaagcagctgcacgtatt
gaagccctccctacctccgacgatactatttctaaagacgctgaggagccaagcagtgta
agtaaagatacttacgccgaagcagctaacaacgacaaaacgctttctgttgataaggac
gagctgagtcttgataaggcatctgtcctgaaagatagcaaaattgaagcagtggaggcc
gaaaaaagttccattgccaaaatcgctaatctacagcctgaagtagatcctaaagcagaa
ctctactactaccctaaaggggatgacctgctgctagtttatgtgacagaagttaatgtt
ttagaacctgccccactgcgtacccgctacattattgatgccaatgacggcagcatcgta
ttccagtatgacatcattaatgaagcgacaggcacaggtaaaggtgtgcttggtgattcc
aaatcgttcactactaccgcttccggcagtagctaccagttaaaagataccacacgcggt
aacggtatcgtgacttacacggcctccaaccgccaaagcatcccaggcacccttttgaca
gatgctgataatgtatggaatgatccagccggtgtggatgcccatgcgtatgctgccaaa
acctatgattactataaatccaaatttggacgcaacagcattgacggacgtggtctgcaa
ctccgttcgacagtccattacggcagccgctacaacaacgctttctggaacggctcccaa
atgacttatggagatggagacggtagcacatttatcgccttcagcggggaccccgatgta
gtagggcatgaacttacacatggtgtcacagaatatacttcgaatttggaatattacgga
gagtccggcgcattgaatgaggctttctcggacgttatcggtaatgacattcaacgcaaa
aactggcttgtaggcgatgatatttatacgccaaacattgcgggcgatgcccttcgctca
atgtccaatcctactctgtacgatcaaccagatcactattctaacctgtataaaggcagc
tccgataacggcggcgttcatacaaacagcggtattatcaataaagcctactacttgttg
gcacaaggcggtactttccatggcgttactgtaaatggaattggccgcgatgctgcggtg
caaatttattatagtgcctttacgaactacctgacttcttcttccgatttctccaacgca
cgtgctgctgtgatccaagccgcaaaagatctgtacggggcgaactcagcagaagcaact
gcagctgccaagtcttttgacgctgtaggcgtaaactaa

DBGET integrated database retrieval system