KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_044780Help
Entry
PPSQR21_044780    CDS       T03178                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq00620  Pyruvate metabolism
ppq00680  Methane metabolism
ppq01100  Metabolic pathways
ppq01120  Microbial metabolism in diverse environments
ppq01200  Carbon metabolism
Module
ppq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPSQR21_044780 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PPSQR21_044780 (ppc)
Enzymes [BR:ppq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PPSQR21_044780 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHM68083
LinkDB All DBs
Position
complement(5076106..5078898)
Genome map
AA seq 930 aa AA seqDB search
MTELTLTANKNQSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIREASKSLRAGYQP
ELYENFKQMVSGLDTDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYEHSAGEEVQPGSI
ESSVQELKQGGFSAEDVSNMLNELSLELVMTAHPTEATRRVILDIHKRISEDVMLLDNPM
LTLREREQVRENLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLDKYYPEQKWHIPTYLRFGSWIGGDRDGNPSVTAHVTWETLCMQRKLALREYQHTLKE
LMGYLSFSTSIVRVSDDLLASIEEDRAHITLKKMEVWHNEKEPYRIKLAYMIAKVNNVLD
ESKQGTKERYSSAEELIADLNVIANSLRHHFADYVADTYIQKMIRQVELFGFHTATLDVR
QHSQEHENAMTEILSKMNIVSDYSKLSEEEKIDLLEQLLNEPRPITSPYLKYSDSTQECL
DVYRTIYLAQEEFGKQSITSYLISMTQGASDLLEVMVLAKEVGLFRIEKDGTVISTLQSV
PLFETIDDLHAAPDIMRRLMNLPVYRQSVAAMDELQEIMLGYSDSNKDGGVVTANWELRV
AMNSITEVVNEYGAKVKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVLSS
RYSLKGIAYRSLEQATSALITAAAYHRSGKKEVFEESWEEIIARISEVSLEKYQDLIFRD
PDFFTFFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSYYQNNEDNLKVLQTMFRDSAFFRSLIDTLQMAIAKADLLIAEEYAGMSDNEEARQ
RIFGQISAEFKLTSELILKITGQSEILDDVPVIQESIRLRNPYVDPLSYLQVQLLSELRE
LRNQNGDDAEMLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcttacgttaaccgctaacaaaaaccaatccaacaatctgctgcggcgggac
gttcgttttctaggaaatattcttggtgaggttttggttcatcaaggtggcaacgaactt
ttggatatcgtggagaaaatacgtgaggcaagtaaatcgttacgtgccgggtatcagccg
gagttatacgagaattttaaacaaatggtcagtggactggatacggatattcgtcaccag
gttattcgcgcgtttgcgatttactttcagttggtgaatatcgctgagcaaaaccatcgt
attcgtcgtaagcgggattatgagcattccgctggtgaagaggttcaacccggttctatc
gaaagttccgttcaggagcttaaacaaggaggcttctccgctgaggacgttagcaacatg
ctgaatgaactctccttggagctggtcatgactgcacatcctacagaagcaacacgacga
gtaattctggatatccacaaacgtatttctgaagacgtcatgctgctggataatccgatg
cttaccttgcgtgagcgagaacaggtacgggaaaatctgcttaatgaagtaattacactg
tggcagacggatgaactgcgtgatcgaaagccaactgtattagatgaagtaagaaatgga
atgtattattttcatgagaccttgtttcatgtattgccagatgtataccaagaattggag
cgatgtttggataaatattatcctgagcaaaaatggcacattccaacttatttgagattt
ggttcttggatcggtggagaccgggacgggaatccatctgttacagctcatgtgacttgg
gaaacgttgtgtatgcaacgcaagctggctttgagagagtatcagcacacgctgaaggaa
ctcatgggttacttgagctttagtaccagcattgtgcgagtttctgatgatttgttggct
tctattgaagaagatcgcgcccacatcacacttaaaaaaatggaagtatggcataacgaa
aaagagccttatcgcatcaaactagcatatatgattgctaaggtgaataacgttttggat
gagagtaaacagggtactaaggaacgctatagctccgcagaagagcttattgcagatctg
aatgtgattgccaacagcctgcgtcatcattttgctgattatgtggcagacacgtatatt
caaaagatgattcgtcaggtagagctattcggctttcatacagctacgctggatgtacgt
cagcacagtcaggagcatgaaaatgcgatgactgaaattctttctaaaatgaatattgtg
tcagattacagtaagctgtcagaggaagaaaaaatagatctgctggaacagctgctaaat
gaaccccgtccgattacttcgccatatttgaaatatagcgatagcacacaggaatgtctt
gatgtatatcgtacgatttatttggctcaggaggaatttggcaagcagtccattacaagc
tacttgatcagtatgactcagggtgccagtgatttgcttgaggttatggtattagccaaa
gaggtaggcctgttccgcattgagaaggatggcactgtcattagtacgctgcaatccgtt
cctttgtttgaaacgatagatgatttgcatgctgcacctgatattatgagaagattgatg
aacctgcctgtatatcgacaatctgtagccgcgatggatgagcttcaggagatcatgctc
ggctactcggatagtaataaggatggcggtgtggttacagcgaactgggaacttcgggtc
gctatgaatagcattacggaagtagtgaacgagtatggcgcaaaagtgaagtttttccac
ggacgtggaggagcgctggggcgcggaggaatgccacttaaccgcagtattctagctcag
cctcctcataccattggtggaggaattaagattacggagcaaggcgaagtgctatcatcc
cgctactcgctcaaggggattgcatatcggagcttggagcaggcgacatcagcgttaatt
acggctgctgcgtatcatcgctcaggaaagaaagaagtgttcgaggaaagctgggaggag
attattgcccgtatttccgaagtatcactggagaagtatcaggatttgattttccgagat
ccagatttcttcactttctttaaagaatctacaccgttgcctgaggtaggcgagctgaat
attggctctcgtccgtccaagcgtaagaacagtgaacgttttgaggatttgcgcgctatt
ccatgggtctttgcgtggacacaaagtcgttacttgctacctgcttggtatgcggcagga
acaggtttgcaaagctactatcaaaacaatgaagataaccttaaagtgctacaaacgatg
tttagagactctgccttcttccggtcgcttattgatacactccaaatggcaatcgctaaa
gcggatttgctgattgcagaggagtatgctgggatgtcggataacgaagaagcacggcaa
cgtatattcgggcagatttctgcagagttcaagctgacatctgaattgattttgaaaata
accggacaatctgagattttggacgatgtacctgttattcaggaatctatccggttgcgt
aatccttatgtcgatccgttaagttatttgcaggttcaattgctgagtgagctacgcgag
ctgcgtaatcagaacggtgatgacgctgaaatgctgcgtgaggtactattgacgattaac
ggaattgccgcaggcttgagaaacacaggctga

DBGET integrated database retrieval system