KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_046460Help
Entry
PPSQR21_046460    CDS       T03178                                 

Gene name
fliD
Definition
(GenBank) flagellar capping protein
  KO
K02407  flagellar hook-associated protein 2
Organism
ppq  Paenibacillus polymyxa SQR-21
Pathway
ppq02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ppq00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PPSQR21_046460 (fliD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ppq02035]
    PPSQR21_046460 (fliD)
Bacterial motility proteins [BR:ppq02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    PPSQR21_046460 (fliD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N Flagellin_IN Glyco_hydro2_C5 DUF1033 ComC MIP-T3_C
Motif
Other DBs
NCBI-ProteinID: AHM68230
LinkDB All DBs
Position
complement(5264343..5265842)
Genome map
AA seq 499 aa AA seqDB search
MRINGFSGMDIDSMVTSLMTAKKTPLNKLNQQKQTLEWTRDSYRELNTKIVQFRDKLSSM
SKSEAMNTQKATLTGNTTAIKAEANADASSTPMSVVVNKLATKSNMQTSTGLRTAGSSTA
DATKNTTLEQIAGGSASDTYELNINDKTITFLKTDTISAVMARINSEGANVTANFDEISG
KFSITAKDYGDKNNIKLTGADKQAKSSTLMDLFQISSTDVKAAEKGEVIVTNTADSSSKT
YNPDNNSLVVNGVSLTLLETTGTTGPAKITTQSDPTKAMETIKSFVDTYNDLLSTFNTKL
SEQKYRDFPPLTADQRKDMKEDEIKQWEEKAKSGLLKNDSILSSAVSSMRMTISSKLGGL
SAVGITTGQYYENGKLQINEEKLKAALTTDPDKVMNIFKGSSADVDSKPIFSELRSKLDT
TLDMFVKKAGTSKFDTNASMTLKADSIMGKQLKNYNSDIKEMTQKLADAETRYYKQFSAM
EKAMSKYQSQSSSLTSFLQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataaatggcttttcaggaatggatatagatagcatggttacatccttaatgact
gccaagaaaaccccgttaaacaagctgaatcagcagaagcagacattagagtggacgcgt
gatagctaccgcgaattaaatactaaaattgttcaatttagagacaaactatcgagcatg
agtaagtcagaggcaatgaacactcagaaagcaacgttaactggtaatacaacggctatt
aaagcggaggctaatgctgatgctagctctacacctatgtctgtagtcgttaacaagtta
gcaacaaagtccaatatgcagacctctacaggtctacgtacagcgggcagcagtacagca
gatgctactaaaaatacaacattggagcaaattgcaggtggcagcgcgtctgatacttat
gagttaaatatcaatgataaaacaatcacgtttctgaaaactgatacaatatctgcagta
atggcccgtatcaactcagaaggggcaaacgtgacagcaaactttgatgaaatcagcggc
aagttctctattacagctaaagattatggggataaaaataatattaaattaactggtgct
gataagcaggctaaaagcagtacgctcatggatttattccaaattagttctacagatgta
aaggcggctgaaaaaggggaagttatagtaacgaatactgcagattcgagttccaaaact
tataatcctgataacaactcccttgtcgttaatggagtgtcgctgactctgttagagact
actggaactactggaccagctaaaatcacaacccagtcagatccaacaaaagctatggag
accattaaatcttttgtggatacttataatgacctattaagtacatttaatacgaaacta
agtgaacaaaagtatcgcgattttcctccactgacagccgatcaaaggaaagacatgaag
gaagatgaaattaagcagtgggaagaaaaggcaaaaagtggtctcctcaaaaatgattca
attttaagttctgctgtctcttcaatgcgtatgactatttccagtaaattaggcggtttg
agtgcggttggtattacaacaggccaatactacgagaatgggaaattacaaattaatgaa
gagaagctgaaggcagctttgacaacagatcctgataaggttatgaatatattcaaaggg
tcctctgctgatgtagacagcaagcccatctttagcgagttgagaagtaagctggatact
acgttagacatgtttgtaaaaaaagcaggtacatcaaaattcgatacaaatgctagtatg
accttaaaggctgacagtataatgggaaagcagcttaagaactataacagcgatattaaa
gagatgacccaaaaactcgctgatgctgaaacacgctattacaagcagttttcggctatg
gaaaaggctatgagcaagtaccagtcgcagtcgtccagtttgacaagctttttacaatag

DBGET integrated database retrieval system