KEGG   Paenibacillus polymyxa SQR-21: PPSQR21_046640Help
Entry
PPSQR21_046640    CDS       T03178                                 

Definition
(GenBank) flgn family protein
Organism
ppq  Paenibacillus polymyxa SQR-21
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN Vps54_N RE_HpaII Ribosomal_S22
Motif
Other DBs
NCBI-ProteinID: AHM68248
LinkDB All DBs
Position
complement(5284660..5285160)
Genome map
AA seq 166 aa AA seqDB search
MPLERLIGVLEQLDQKHLILLELAKSKKKIVMENDMDSLVQHLNQESRLLKQVEQLEEAR
MEVSYELLRERGIKSQLNLTITELARLVFDLEDKNKLLSVQSRLSHTLSELKEINEINQK
LIEQSLVFIDYSLDLLVGRPNQEMTYMHPDQKSNQHARPGLFDTKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagagcgtttgattggtgtgctggaacagctagatcaaaagcatcttatttta
ttagaactggcgaaaagtaaaaaaaagattgtcatggaaaatgatatggatagcctggta
cagcatttgaaccaggaatccagactccttaaacaagtagaacagttggaagaagctcgt
atggaggtttcgtatgagcttcttcgtgaacgtggtattaagtctcagcttaatttgact
ataaccgagctggcgcgccttgtctttgatctagaagataagaacaaactcctcagtgtc
cagagccgcttatcccacactctttcagaattaaaggaaattaatgaaatcaatcaaaaa
ctcatcgagcaatcgttggtgtttattgattactctttagatctacttgtaggacgtcct
aatcaggagatgacttatatgcatcctgatcagaagagtaatcaacacgcacgacctgga
ttgtttgacactaaggcttga

DBGET integrated database retrieval system