KEGG   Photobacterium profundum: PBPRA1498Help
Entry
PBPRA1498         CDS       T00173                                 

Gene name
SO1769
Definition
(GenBank) hypothetical Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ppr  Photobacterium profundum
Pathway
ppr00250  Alanine, aspartate and glutamate metabolism
ppr00410  beta-Alanine metabolism
ppr00430  Taurine and hypotaurine metabolism
ppr00650  Butanoate metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PBPRA1498 (SO1769)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PBPRA1498 (SO1769)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PBPRA1498 (SO1769)
   00430 Taurine and hypotaurine metabolism
    PBPRA1498 (SO1769)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PBPRA1498 (SO1769)
Enzymes [BR:ppr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PBPRA1498 (SO1769)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CAG19909
UniProt: Q6LS17
LinkDB All DBs
Position
1:complement(1700030..1701679)
Genome map
AA seq 549 aa AA seqDB search
MAVDNRKADATLESLHRIFTVPEAPESTLGLIEQKISQNLNEFLGTHIAAREKPLIEIEK
DFSSAEIPENPSFVSDHTQFLLTKLVAQSVHTSAPSFIGHMTSALPYFLMPLSKIMIGLN
QNLVKIETSKAFTPLERQVLGMMHNLIFNEETSFYQQWMHSADHSLGAFCSGGTIANITA
LWVARNNVLKPDGEFKGVANEGLFRAMKHYGYDDLAILVSERGHYSLKKAADVLGIGRDC
LIPIKTDDNNRIRVDDLTATLQSLKEKNIKPFAIIGVAGTTETGNIDPLDELADIAQAHD
CHFHVDAAWGGATLMSNKYRSLLKGIERADSITIDAHKQLYVPMGAGMVIFKNPALMTSI
EHHAEYILRKGSKDLGSHTLEGSRSGMAMLLFASLNIISRQGYEMLINNSIDKAKHFANM
VKQDPDFELVTEPELCLLTYRYVPAETQQALTIANAEDKHLLHDALNDLTKFIQKRQRES
GKSFVSRTRLTPEKWDHKITTVFRVVLANPLTTDNILQDVLIEQKELAKESVHSLPRLFT
LTKRILANN
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggataatagaaaagccgatgcgactttagagtcattacatcgcatttttacg
gtgccggaagcacctgaatcaaccctagggctgatcgagcaaaaaatctcacaaaaccta
aatgaatttttgggtacgcatattgctgcgcgcgaaaagccgcttatagagattgaaaag
gatttctcatctgctgaaattccagaaaatcctagctttgtatccgatcacactcaattt
ttgctgactaagctggttgctcagtcggttcatacgtctgcgccaagctttattggccac
atgacgtctgccctaccgtattttttgatgccgttatcaaaaattatgatcggtctaaac
cagaacttggtaaagattgaaacctcaaaggcattcacccccctagaacgccaagtttta
ggcatgatgcacaacttaatcttcaatgaagagacaagtttctatcagcagtggatgcac
agtgcagaccattcattgggggctttttgttctggcggcacaattgccaatattaccgca
ctttgggtagcacgtaacaatgtgttaaagccagatggtgagtttaaaggtgtggcaaat
gaaggtctattccgtgcaatgaagcattacggatatgatgaccttgcaatacttgtctct
gaacgtggtcactattcactaaaaaaagcagctgatgtcttaggtattggccgtgattgt
cttattccaataaaaacggatgacaataaccgaatccgagttgatgatctaactgctacg
ctccaatccctaaaagaaaagaatattaagccattcgccattattggtgtggctggtaca
actgaaacaggaaatattgatccgctagacgagttagccgatattgcacaagcgcacgat
tgtcatttccatgtcgatgcagcttggggcggcgcgaccttaatgtcgaataaataccgt
tctttattaaaagggatcgagcgagcagattcgattactattgatgcgcacaaacagctg
tacgtaccaatgggagctggcatggttatcttcaaaaacccagctttgatgacatcaatt
gaacatcacgctgaatatattcttcgtaaaggctctaaagatttgggtagccatacttta
gagggctcacgtagtggtatggcaatgctactgtttgcaagcttaaatattattagccga
caaggctatgaaatgttgatcaacaacagtattgataaagcaaaacatttcgcaaatatg
gttaagcaagatcccgatttcgagctagttaccgaaccggaattatgcttgctcacctat
cgatatgttcccgcagaaacgcagcaagcactaacgattgcaaatgccgaagataaacat
ctattacatgatgcacttaatgaccttacgaaatttattcaaaagcgtcagcgtgaatcg
ggtaaatcttttgtatcacgtacgcgtttaacacctgaaaagtgggaccacaaaattaca
accgttttcagagttgtactggcgaacccactaacgacggataacattttgcaagatgtt
ttaatcgagcaaaaagaactcgcgaaagaaagtgtacatagcttgccacgtttgtttact
ttaactaaacgtattttggcaaataactag

DBGET integrated database retrieval system