KEGG   Photobacterium profundum: PBPRA1720Help
Entry
PBPRA1720         CDS       T00173                                 

Gene name
YHJO
Definition
(GenBank) Putative cellulose synthase catalytic subunit [UDP-forming]
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ppr  Photobacterium profundum
Pathway
ppr00500  Starch and sucrose metabolism
ppr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PBPRA1720 (YHJO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppr01003]
    PBPRA1720 (YHJO)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppr02000]
    PBPRA1720 (YHJO)
Enzymes [BR:ppr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     PBPRA1720 (YHJO)
Glycosyltransferases [BR:ppr01003]
 Polysaccharide
  Structural polysaccharide
   PBPRA1720 (YHJO)
Transporters [BR:ppr02000]
 Other Transporters
  Others
   PBPRA1720 (YHJO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_trans_2_3 Glyco_tranf_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: CAG20127
UniProt: Q6LRE9
LinkDB All DBs
Position
1:1966026..1968656
Genome map
AA seq 876 aa AA seqDB search
MSMYSGLNVIFKSWIVNTFFQQLKVYEHDGGGASNRIGRFILFIWFTFCFIFLKEKINET
PSWKLLLLYYPQINFARPKVLDLLRFIVQSFWLLIVRQDLSNTNNVAVKNYSLRLNNKIV
SVFHMPFEYLSLLVIWLEKKASSSESVPFVKKNKNDELFNAVNYVLLFIVLLLIFLCFTV
PFNLQAQTVFIIILWSLAMMFRRMPGRFPTMLLIVLSLTASCRYIWWRYTSTLNWDEPLA
LVLGLILLLAETFAWVVLILGYFQNIWPLNRKPALLPVDTTLWPSIDLMIPTYNEDLDVV
KATVYASLGVDWPKDKLNIYILDDGKRDSFKKFAKEAGVHYIRRPLNNYAKAGNINYALE
RSGGEYVAIFDCDHIPTRAFFQLTMGLFLNDPKLALVQTPHHFFSPDPFERNLSNFRDVP
NEGSLFYGLIQDGNDLWDGTFFCGSCAVLRRKPLEEVGGIAVETVTEDAHTSLRMHRLGY
SSAYLKQPLSAGLATETLSAHVGQRIRWARGMAQIFRVDNPLTGKGLKWQQRLCYANAML
HFLSGIPRIIFLIAPLAFLLLHSYVIYAPALAIVLYVLPHMVHASITNSRIQGDYRFSFW
GEVYETVLAWYIARPTTIALFAPHKGTFNVTAKGGLIHKTHYDWVISKPYLALVFLNIIG
AGFGIYRLGWGPTDEIATVIVNVLWTVYNLLILGGAVAVAAETKQIRKDHRVPVKIPMTI
RLYSGHLLQAEMNDFSLGGIRVVIGQSLALQQGQKLDIILSRADQEFIFPAKITYSNGST
MGLQLEPLTTQQEVDYVQCTFARADTWTKWQQGYQTDKPLMSMKSVLKVGFNGYPSLLQH
SPKPVVLIVQSFLKVGDFVGSFRPRNTLTRANDNAN
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatgtatagtggtttaaacgtgatatttaaaagctggattgttaatacatttttt
cagcaattgaaagtttatgagcatgatgggggaggagcttctaatcgtataggtcgtttt
attctttttatctggtttacattctgctttatctttttgaaagagaaaatcaatgaaaca
ccgagttggaaattactcttactgtattacccgcaaataaatttcgccaggccaaaagtg
ttggatttactacgttttatagtacagtcgttttggctgttaattgttaggcaagacctc
tctaatacaaataatgttgcagtaaaaaactattcattaagactgaataacaaaattgtg
agtgtttttcatatgccttttgagtatctttcattactggttatttggcttgaaaaaaaa
gcaagctcgtctgagagtgtgccttttgtaaagaaaaataaaaatgatgaattatttaat
gccgttaattatgtgctgttgttcattgttttattattgatttttttgtgttttaccgta
ccttttaacttacaagctcagactgtttttataattattttgtggtcattagccatgatg
ttcaggcgaatgcctggtcgttttccaacaatgctattgattgtgttgtcacttactgcc
tcttgccgctatatatggtggcgttatacatcgacactaaattgggatgaacctctcgcg
cttgttttagggcttatattgttactagcagaaacattcgcatgggttgtcttgatactc
ggctattttcaaaatatttggccacttaatcgtaaacctgctctcttacctgttgatacg
acgctttggccaagtattgatttgatgataccgacttataatgaagatcttgatgttgtg
aaagcaacggtttatgcatcacttggtgttgattggccaaaagataaattgaatatctat
attctagatgatggaaaaagagatagttttaaaaaattcgccaaagaagcaggtgttcat
tatattcgacgacctttaaacaattatgctaaagcgggtaacattaactacgcgcttgaa
cggtcgggtggtgaatatgtggctatttttgactgtgatcatattccaacacgtgctttt
ttccaattaactatggggctatttcttaacgatcctaagcttgcccttgtacaaacacct
catcattttttctcgccggatccttttgaaagaaatttatcgaattttcgtgatgtccca
aatgagggaagccttttttatggcttgattcaagatggaaatgatttatgggacggtaca
tttttctgcggttcgtgtgcggttttacgccgtaagccgttggaggaggtggggggcata
gctgtcgagaccgttacagaagatgcacatacatcattacgcatgcatcgccttggctac
agttctgcttatttaaagcaacctttatcggcaggtttggcgacagaaacgctctctgcc
catgtagggcagcgtattcggtgggcaaggggaatggcacaaatatttagagtcgataac
cctttaactggtaaagggttaaaatggcaacaacgcctttgctatgccaacgcgatgctg
cattttctttctggtattccgcgaattattttcttgattgcccctctagcttttttatta
ctacactcttatgttatttatgcgcctgcgttagcaatcgttctttatgtattacctcat
atggttcatgccagtattacaaactcaagaatacagggggattatcgtttctcattttgg
ggggaggtttatgaaacagtattagcatggtatatcgcacgtcccacgacgattgcgtta
tttgctcctcataaaggcacctttaatgtaactgcgaaaggtgggttaattcataaaaca
cattatgactgggtaatatcgaaaccctatttggcgttagtctttcttaatattattggt
gctggttttggtatttatcgactggggtgggggccaacagatgagattgcgactgtgata
gtcaatgttttatggacagtatataacctcttgatccttggcggtgcagttgcggttgct
gctgaaacaaagcaaattcgaaaagatcaccgagtgcccgttaaaattccgatgacgata
cgtttgtactctggtcatttactgcaagctgaaatgaatgacttttctttaggtggaata
cgggttgtcataggtcagtcgctagcattacagcaaggtcagaagctagacataatatta
agccgagcagatcaagagtttatttttcctgcaaagataacctattcgaatggcagtact
atgggtttgcaattagagccattaacgactcagcaagaagttgattatgtgcaatgtact
tttgcgcgtgcagatacctggactaaatggcagcaaggctatcaaactgataaaccgttg
atgagtatgaaaagcgtactcaaagttggttttaatggttaccccagtttattgcaacac
agtcccaaaccggttgtattaattgtgcagagttttctaaaagtgggtgattttgttggg
tcatttagaccaaggaatacattaacaagagcaaacgataatgcgaattaa

DBGET integrated database retrieval system