KEGG   Photobacterium profundum: PBPRA2578Help
Entry
PBPRA2578         CDS       T00173                                 

Gene name
SODB
Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PBPRA2578 (SODB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAG20957
UniProt: Q6LP19
LinkDB All DBs
Position
1:2985330..2985914
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVKLNGLVEGTDLAEKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHSLSPNAGGEPTGEVADAIAKAFGSFEEFKAKFTDSAINNFG
SSWTWLVKNADGSLAIVNTSNAGTPITEEGVTPLLTVDLWEHAYYIDFRNVRPDYMAAFW
SLVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccagctctaccgtacgcaatcaacgctcttgagccacatatctct
caagaaacgctagaataccaccacggtaagcaccacaacacttacgttgttaagctaaac
ggccttgttgaaggtactgatctagcagagaagtctcttgaagaaatcatcaagacttca
actggtggtgtatttaacaacgcagctcagatctggaaccacacgttctactggcacagc
ctaagccctaacgctggcggcgaaccaacgggtgaagtagcagacgctatcgctaaagca
ttcggttctttcgaagaattcaaagcgaaattcactgattcagcaatcaacaacttcggt
tcttcttggacttggcttgttaagaacgctgacggctctctagcaatcgtaaatacatct
aacgctggtactccaatcacagaagaaggtgttactcctcttcttactgttgatctgtgg
gaacacgcttactacatcgatttccgtaacgttcgtcctgattacatggctgctttctgg
tcactagtaaactgggaattcgtagcgaagaacctagcggcataa

DBGET integrated database retrieval system