KEGG   Photobacterium profundum: PBPRA2626Help
Entry
PBPRA2626         CDS       T00173                                 

Gene name
AAT
Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppr  Photobacterium profundum
Pathway
ppr00220  Arginine biosynthesis
ppr00250  Alanine, aspartate and glutamate metabolism
ppr00290  Valine, leucine and isoleucine biosynthesis
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01130  Biosynthesis of antibiotics
ppr01210  2-Oxocarboxylic acid metabolism
ppr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PBPRA2626 (AAT)
   00290 Valine, leucine and isoleucine biosynthesis
    PBPRA2626 (AAT)
   00220 Arginine biosynthesis
    PBPRA2626 (AAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppr01007]
    PBPRA2626 (AAT)
Enzymes [BR:ppr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PBPRA2626 (AAT)
    2.6.1.66  valine---pyruvate transaminase
     PBPRA2626 (AAT)
Amino acid related enzymes [BR:ppr01007]
 Aminotransferase (transaminase)
  Class I
   PBPRA2626 (AAT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAG21005
UniProt: Q6LNX1
LinkDB All DBs
Position
1:3041896..3043110
Genome map
AA seq 404 aa AA seqDB search
MHNIGMSSKLNNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYPARKAIVQHYQKRGLLDLDVEDVYIGNGVSELIVMAMQALLDNND
EILVPSPDYPLWTAAVSLSGGNPVHYICDEESDWYPDLDDIKKKITPNTRGIVLINPNNP
TGAVYSRDFLLEIVEIARKHKLIIFADEIYDKILYEGAQHTSIAPLAPDVFCITFNGLSK
SYRVCGFRAGWMVLSGPKHEAKGYIEGLEMLSSMRLCANVPMQHAIQTAIGGYQSINELI
LPGGRLLEQRDKAYDLITQIPGVSCVKPKGALYLFPKLDQKKFNIVDDQRMALDFLQQEK
VLIVHGTGFNWEKPDHFRIVTLPRVDDLEMAIGRLERFLHNYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcataacatcgggatgtcctccaagcttaataatgtctgctatgacatacgtggtccc
gttctgaagcatgccaagcgcatggaagaagaaggccataaaattttaaagcttaatatt
ggtaatcccgccccatttggtttcgatgccccggatgagattctggttgatgtgatccgt
aacttaccgacatctcaagggtattgtgattcaaaaggcatttatcctgcacgtaaagcc
attgttcagcattaccaaaaacgcggtttactcgatcttgatgttgaagatgtttatatc
ggtaatggtgtatctgaattgatcgtcatggcgatgcaagctttactagacaacaacgat
gaaatcttagttccctctcctgactatccattatggaccgcagcggtttctttgtctggt
ggtaacccagtacattatatttgtgatgaagagtcagattggtatccagacctcgatgat
attaagaaaaaaatcacccccaatactcgcggcatcgtattaatcaatccgaataatcca
acgggtgccgtttatagccgcgatttcttactcgaaatcgttgagattgcacgtaagcat
aagctgatcatttttgcagatgaaatctatgacaagattttatatgaaggggctcaacac
acctctatcgcgccacttgcgccagacgttttctgtatcacgttcaatggcctttctaag
tcataccgcgtgtgtggtttccgtgcaggttggatggtgctatcaggtcctaagcatgaa
gctaaggggtatatcgaagggttagagatgctgtcgtctatgcgtctgtgtgccaacgta
cccatgcagcatgctattcaaacggcgattggtgggtatcagagtattaatgagcttatc
ttaccgggtgggcgtttattagagcagcgtgacaaagcctatgacttgatcactcaaatc
cctggcgtttcttgtgtgaagcccaaaggagcgctatatctatttccgaagttagatcag
aaaaaattcaacatcgttgatgatcaacgcatggcactggatttcttacaacaagaaaaa
gtgcttatcgtgcatggtacgggctttaattgggagaaaccggaccatttccgtattgtg
accttaccccgtgtcgatgatttagaaatggcaattggtcgactagagcgcttcttgcac
aattatcgtcaataa

DBGET integrated database retrieval system