KEGG   Photobacterium profundum: PBPRA3385Help
Entry
PBPRA3385         CDS       T00173                                 

Gene name
ALR
Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppr  Photobacterium profundum
Pathway
ppr00473  D-Alanine metabolism
ppr01100  Metabolic pathways
ppr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PBPRA3385 (ALR)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PBPRA3385 (ALR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppr01011]
    PBPRA3385 (ALR)
Enzymes [BR:ppr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PBPRA3385 (ALR)
Peptidoglycan biosynthesis and degradation proteins [BR:ppr01011]
 Precursor biosynthesis
  Racemase
   PBPRA3385 (ALR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CAG21670
UniProt: Q6LM08
LinkDB All DBs
Position
1:3826887..3828101
Genome map
AA seq 404 aa AA seqDB search
MKLKLSLVALALMGQTTANAAPLLVDFDNNEREERVQSSNAWLEIDTQAFSGNIQLLQNQ
LKADTKICAIMKADAYGNGIAGLMPSIIANQVPCVGITSNEEARVVRKHGFIGKIMRVRA
ASKNEIEGGLQYQMEELIGTKAQADQIIEIARANGTTIPVHLALNTSGMGRNGLDLTTYE
GQVEGVEIAGDPNLEIVGMMTHFPNEGLDEIKRKVKRFKVETKWLMDSTDLKRKDVTLHV
ANSYITLNLPEAHLDMVRPGGMLYGDYPATAPYQRIVSFKTHVASLHHFPAGSTIGYGST
AVLERDSVLANLPIGYSDGFARSLGNKAEVLINGQRARVMGMVSMNTTMVDVTDIVDVQT
NEEVVIFGRQGFEEITGEETEEKSNRILPEHYTVWGATNPRIYR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgaaacttagcctagttgctcttgccctaatgggtcaaactaccgccaatgcc
gcccctctgctggtcgatttcgataataacgagcgcgaagaacgcgttcagtcaagcaat
gcatggctggaaatcgatacccaagcattttctggcaacattcagttacttcaaaaccag
ctaaaagccgatacaaaaatctgcgctatcatgaaagccgacgcttacggtaatggtatc
gcaggcctaatgccatccatcatcgccaaccaagtgccatgtgttgggatcaccagcaac
gaagaagctcgtgtggtacgtaagcacggtttcattggcaaaatcatgcgagtacgtgcc
gcgagcaaaaatgaaattgaaggcggcctgcaataccagatggaagaattaatcggtacc
aaggcacaagccgatcaaatcatcgaaatcgcccgagcaaacggcacaactatcccggtt
cacctagcactgaatacctcaggcatggggcgtaacggtctggatctgacaacttatgaa
ggtcaggtagaaggtgtcgaaatcgctggcgatcccaatctggaaatcgtaggcatgatg
acccacttcccgaacgaaggccttgacgaaatcaagcgcaaggtaaagcgcttcaaggta
gaaacgaaatggctgatggacagcaccgatctaaagcgtaaggacgtcaccctacatgtt
gccaactcttacattacgctgaacttacccgaagctcacctagacatggttcgcccaggc
ggcatgctttacggcgattacccagcaacagcaccataccagcgcatcgtttcattcaaa
acacatgttgcgtcactgcaccacttcccagcaggcagcaccatcggctacggcagtacc
gcggtactagagcgcgattctgtactggcaaaccttcctatcggctactcagacggcttt
gcccgctctctgggtaacaaggcagaggtactgatcaacggccagcgtgctcgcgtgatg
ggcatggtatcaatgaacaccaccatggtcgatgtcacagacatcgtcgacgtacagacc
aacgaggaagtggttatttttggccgtcaaggctttgaagaaatcactggcgaagagacc
gaagagaaaagcaatcgtattctgccagaacattacactgtttggggtgcaaccaaccca
cgtatctaccgttaa

DBGET integrated database retrieval system