KEGG   Photobacterium profundum: PBPRA3439Help
Entry
PBPRA3439         CDS       T00173                                 

Gene name
SO0217
Definition
(GenBank) putative GTPase-translation elongation factor
  KO
K02358  elongation factor Tu
Organism
ppr  Photobacterium profundum
Brite
Translation factors [BR:ppr03012]
 Eukaryotic Type
  Elongation factors
   PBPRA3439 (SO0217)
 Prokaryotic Type
   PBPRA3439 (SO0217)
Mitochondrial biogenesis [BR:ppr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PBPRA3439 (SO0217)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PBPRA3439 (SO0217)
  Exosomal proteins of breast cancer cells
   PBPRA3439 (SO0217)
  Exosomal proteins of colorectal cancer cells
   PBPRA3439 (SO0217)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CAG21723
UniProt: Q6LLV5
LinkDB All DBs
Position
1:complement(3892644..3893852)
Genome map
AA seq 402 aa AA seqDB search
MPCLEGLSMSKEKFERLKPHVNVGTIGHVDHGKTTLTAAICTVLAKVYGGDAKDFASIDN
APEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGP
MPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDCPVIM
GSALGALNGEAQWEEKIIELAEALDNYIPEPERAIDLPFILPIEDVFSIQGRGTVVTGRV
EQGIVRIGEEVAIIGIKETTTTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQV
LAKPGSITPHTTFESEIYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVM
PGDNIQMKVTLIAPIAMDEGLRFAIREGGRTVGAGVVAKIFE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtctagagggactatccatgtctaaagaaaaatttgaacgtctaaaaccgcat
gttaacgttggtacaatcggccacgtcgatcacggtaaaacaactctaactgctgctatc
tgtactgtacttgcaaaagtgtacggtggtgatgcaaaagacttcgcttctatcgataac
gctccagaagagcgcgagcgcggtatcacaatttctacttctcacgtagaatatgatact
cctgctcgccactatgcacacgttgactgtcctggacacgccgattatgttaaaaacatg
atcactggtgctgctcaaatggatggtggtatcctagttgttgctgcaactgatggccct
atgccacaaacacgtgagcacatccttcttggtcgtcaggttggtattccttacatcatc
gtattcatgaacaaatgtgacatggttgatgatgaagagctactagaattagtagaaatg
gaagttcgtgaacttctatctgaatacgatttcccaggtgatgattgcccagtaatcatg
ggttctgcactaggtgcacttaacggtgaagctcagtgggaagagaaaatcattgaacta
gctgaagctctagataactacatcccagagccagagcgtgcaattgatcttccattcatc
cttccaatcgaagatgttttctcaattcaaggccgtggtactgttgtaactggtcgtgtt
gagcaaggtatcgtacgtattggtgaagaagttgcaatcatcggtatcaaagagactacc
actactacatgtactggtgttgaaatgttccgtaagcttcttgacgaaggccgtgctggt
gagaacgttggtgttcttctacgtggtactaagcgtgatgacgttgaacgtggtcaagtt
cttgctaagcctggttcaatcaccccgcacactacgtttgagtcagaaatctacgttctg
tctaaagatgaaggtggtcgtcacactcctttcttcaaaggctaccgtccacagttctac
ttccgtacgactgatgtaacgggtactattgaattgccagaaggcgttgagatggttatg
cctggcgataacattcagatgaaagttacgctaattgcgcctatcgcgatggatgaaggt
ctgcgctttgcgatccgtgaaggtggtcgtacagttggtgctggtgttgttgccaagatc
tttgaataa

DBGET integrated database retrieval system