KEGG   Photobacterium profundum: PBPRB0616Help
Entry
PBPRB0616         CDS       T00173                                 

Gene name
MRCB
Definition
(GenBank) hypothetical membrane carboxypeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ppr  Photobacterium profundum
Pathway
ppr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PBPRB0616 (MRCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppr01003]
    PBPRB0616 (MRCB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppr01011]
    PBPRB0616 (MRCB)
Enzymes [BR:ppr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PBPRB0616 (MRCB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PBPRB0616 (MRCB)
Glycosyltransferases [BR:ppr01003]
 Polysaccharide
  Bacterial polysaccharide
   PBPRB0616 (MRCB)
Peptidoglycan biosynthesis and degradation proteins [BR:ppr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PBPRB0616 (MRCB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter AveC_like GEN1_C
Motif
Other DBs
NCBI-ProteinID: CAG22489
UniProt: Q6LJP1
LinkDB All DBs
Position
2:735560..737950
Genome map
AA seq 796 aa AA seqDB search
MTMSDKHKQHEPSSPLDDSKTAPESASPDGKQPTPTSPNPTPPKKTKRVWIKRSLIGAVI
LGSVSMVWMGFSLNQAVSEKFEGQLWQLPSVVYARELTLQPGAPIRFDDLVNELKVLKYR
KVASPKQSGEYSVSRQRVELVRRPFEFKEGIEGARHVVVDFDYASIKRISEVESNRELGF
LRVEPKMLGMLEAKAEEQRIYLPKDEMPEHLIQALLTTEDRNFYEHDGVSPVAIARAFLA
NLKAGRTVQGGSTLTQQLTKNLFLSSERSLWRKFKEAYMALIIDYRYDKDQILDGYLNQV
YLAQSGADAIHGFALGARFYFGRPLSELRVDQQALLVGLVKGPSYYNPWRYPERVKQRRD
LILSMMMDSKQLEPADYEAAIKLPLDLQEKGQIANRQPAYFEQIKRELKANVGDDYQPDK
GLRLFTSLDPLSQEKAELAVRQTVPKLEKKAGKELETAVVIADRMSGEIRAMVGGSRPGY
AGFNRAIDAKRQIGSIVKPAIYLAALEQPERFSLATSLKDRPLTLKGAKGENWSPRNYDR
QYRGEVPLYQALAKSYNIPTVNLGLAVGLDTVIDTLDKLGVDRKEVPKLPSMLLGAFTLT
PLQVTQMYQTIASGGHKAELTALSAVTDGKGNIIYQNWPTSSPAVPAQAAWLTMYGMQKV
VSTGTGRYLNAQFPSSHLAGKTGTTDKNRDSWYVGIDGREVVTVWMGRDDNKGINLTGSS
GALRLYSDYIKQRDPEALVLRRPAQITNFTYSQSQNGTYSASCVGQSKLPAWDPKGNLQP
SCVKSVEGFLQKLFSW
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgtcagataaacacaaacagcacgaaccaagctcaccacttgatgattctaag
acagcaccagaatcagcgtctcccgacggtaagcaaccgactcctacgtcaccaaatcct
actccaccaaagaagacgaaacgtgtgtggattaagcgctcgctgattggtgccgtaata
ttgggttcggttagcatggtatggatgggtttttcacttaaccaagccgtaagtgaaaaa
tttgaagggcaactttggcagttaccttcggttgtctatgcgcgtgaactgactcttcag
ccgggtgctcccattcgatttgatgatttagttaacgaacttaaggtattaaaatacaga
aaagttgcctcaccaaagcaaagtggtgagtattcggtaagccgtcagcgtgttgagctt
gtacgccgtccctttgaatttaaagaaggcattgaaggcgctcggcatgttgtggttgat
tttgactatgcatcgattaaacgtatttcagaagtcgagtcaaaccgagaattaggcttt
cttcgtgtagagcctaaaatgctgggtatgttagaagcaaaagccgaagaacagcgtatt
tatttaccgaaagatgaaatgcctgagcatttaattcaagctttgctcacgacagaagat
cgtaatttttatgagcatgatggtgtttctcccgttgcgattgcgcgtgcatttttagct
aatctaaaagcgggtagaaccgttcaaggcggcagtacgcttactcagcagttgaccaaa
aaccttttcttaagtagtgaacgtagcttatggcgtaaattcaaagaagcgtacatggcg
ttaatcattgattaccgttatgacaaagatcagatccttgatggctacttaaaccaagtg
tatttagcacaaagcggggcagatgctattcatggttttgcgttgggagcacgtttctat
tttggacgccctttgtctgaattacgtgtcgaccaacaagctttgctggtggggttagta
aaaggtccatcatattataatccatggcgataccctgagcgtgtgaaacaacgtcgtgat
ttaattctcagcatgatgatggattcaaagcagctagaaccggcagattatgaagccgca
ataaagttacccttagatttacaagaaaaaggtcagattgccaatcgccagcccgcgtat
tttgagcaaattaaacgagaactaaaagcgaatgttggtgatgactatcagccagataaa
ggtttacgattgttcacatcactcgaccctttatcgcaagaaaaagcagaattagcggtt
cgacaaacggtgcccaaattagagaaaaaggcaggtaaagaactagaaactgccgttgtt
attgcagatcgtatgtctggcgaaattcgagcaatggtaggcggaagtcgtccgggatat
gctggctttaaccgcgctattgatgccaaacgtcagattggttctatcgttaaacctgcc
atctatcttgctgcacttgaacagccagaacgtttttctctcgcaacaagcttgaaagat
cgaccgcttacgttaaaaggggcaaaaggcgagaattggtcgccacgtaactatgatcgc
caataccgtggtgaagtgccgttgtatcaagctttggctaagtcttacaatattcctacc
gtgaatcttggcttggctgttgggcttgataccgtgattgatacgcttgataagttgggt
gtcgatcggaaagaagtgcccaagttaccttctatgttattaggcgcatttacattaacg
ccattacaagtgacccagatgtatcaaaccattgcgagtggtggtcataaagccgaactt
acagcattaagcgcagtaacagatggtaaaggcaatatcatttatcaaaattggccaaca
tcatcccccgcagtacctgcacaagctgcttggttaacgatgtatggtatgcaaaaagta
gtttcgactggtactggtcgttacttgaatgcacaatttccctcatcacatttagcgggt
aaaacaggtacaacagataaaaaccgtgatagctggtatgtcggtattgatggacgagaa
gttgtgactgtttggatggggcgagatgataataaaggtattaatctaacgggttcttct
ggggcgctaagattgtattctgattatattaagcagcgtgatcctgaagcattagtgcta
cgtcgccctgctcaaattacgaacttcacatacagtcaatctcagaatggtacgtattca
gccagctgtgtggggcaaagtaagttgccagcatgggatccgaaaggaaaccttcaaccc
agttgcgttaagagcgtggaaggctttttacaaaaattatttagttggtaa

DBGET integrated database retrieval system