KEGG   Pseudomonas protegens CHA0: PFLCHA0_c22200Help
Entry
PFLCHA0_c22200    CDS       T02671                                 

Gene name
bdhA1
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFLCHA0_c22200 (bdhA1)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PFLCHA0_c22200 (bdhA1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PFLCHA0_c22200 (bdhA1)
    1.1.1.-  
     PFLCHA0_c22200 (bdhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-ProteinID: AGL83991
UniProt: A0A2C9EK23
LinkDB All DBs
Position
2465721..2466824
Genome map
AA seq 367 aa AA seqDB search
MSVSLKPVPSMRAAVWHGRHDIRVEDVPLPEAPPAGWVQIRVDWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVALGEGVQGFSLGQPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYALPANFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGATHVLDPKECDAL
AEVKRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVMVGIFEEPSEFNFFELVATEK
TVLGALAYNGEFADVIAFIADGRLDISPLVTGRIQLEEIVGQGFEELVNNKEHNVKIIVS
PGQLRRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttccctcaagcctgttcccagcatgcgtgccgcggtctggcacggccgccac
gatatccgcgtcgaagacgtaccgctgcccgaggcgccgcctgccggctgggtgcagatc
cgcgtcgattggtgcggcatctgcggctccgacctgcacgaatacgtggccgggccggtg
ttcattccggtggacgcaccgcacccgctgaccgggatcaagggccagtgcatcctcggc
cacgagttctgcggcgaaatcgtcgccctgggcgaaggggtccagggtttcagcctcggc
cagccggtggcagccgacgcctgccagcactgtggcacctgctattactgcacccacggc
ctgtacaacatctgcgaaaacctggcctttaccgggctgatgaacaacggcgccttcgcc
gaattggtcaacgtgccggccaacctgctgtacgccttgccggccaactttcccgccgag
gccggagcgctgatcgagccgctggcggtgggcatgcacgcggtgaaaaaagccggcagt
ttgttggggcagaacgtggtggtggtcggcgccggcaccatcggcctgtgcaccatcatg
tgcgccaaagccgccggcgcggcccaggtgatcgccctggaaatgtccggcgcgcgcaag
gccaaggccctggaggtgggcgcgacccacgtgctcgaccccaaggagtgcgatgccctg
gccgaggtcaagcgcctgaccggcgggctgggggccgatgtcagctttgagtgcatcggc
aacaagcacaccgccaagctggccatcgacctgatccgcaaggccggcaagtgcgtgatg
gtgggaatattcgaagagcccagcgagttcaacttcttcgagctggtggccaccgagaaa
acggtgctgggggccctggcctacaacggtgagttcgccgatgtgatcgcctttatcgcc
gatggccggctggatatttcgcccctggtgaccgggcgcatccaactggaagagatcgtt
ggccagggcttcgaggaactggtcaacaacaaggaacacaacgtcaagatcattgtttct
cccggtcagttgcgacgctcgtaa

DBGET integrated database retrieval system