KEGG   Pseudomonas protegens CHA0: PFLCHA0_c27410Help
Entry
PFLCHA0_c27410    CDS       T02671                                 

Definition
(GenBank) hypothetical protein
Organism
pprc  Pseudomonas protegens CHA0
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGL84512
UniProt: A0A2C9ELI2
LinkDB All DBs
Position
complement(3001525..3001926)
Genome map
AA seq 133 aa AA seqDB search
MNPSPAIRQPCPPGACICEREQLLDTPGADLRILNLTRQEEKRLLERLENLKDLADLEHM
QRRMYEQLGIRVQISPSDNVVRSMRGIAISLGELPGLCRKTRQSIPAAIRRAMEQRPEIA
YRLLDSQDLLRGT
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccagccccgcgatccgccaaccctgtccgcccggcgcctgcatttgcgagcgc
gagcagttgctggacacccccggagccgacctgcgcatcctcaatctgacgcgccaggag
gaaaaacgcctgctcgaacgcctggaaaacctcaaggacctggcggacctggaacacatg
cagcggcggatgtacgaacaactgggcatccgcgtccagatcagccccagtgacaacgtg
gtccgcagcatgcgcggcatcgccatttccctgggcgagttgcccggcctgtgccgcaag
acccggcaatcgatcccggccgccatccgccgggccatggagcagcgcccggaaatcgcc
taccgcctgctggactcccaggacctgttgcgcggcacctga

DBGET integrated database retrieval system