KEGG   Pseudomonas protegens CHA0: PFLCHA0_c29190Help
Entry
PFLCHA0_c29190    CDS       T02671                                 

Gene name
treS
Definition
(GenBank) trehalose synthase TreS
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00500  Starch and sucrose metabolism
pprc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFLCHA0_c29190 (treS)
Enzymes [BR:pprc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PFLCHA0_c29190 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PFLCHA0_c29190 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGL84689
UniProt: A0A2C9EM62
LinkDB All DBs
Position
3229776..3233123
Genome map
AA seq 1115 aa AA seqDB search
MAKKPRPTTFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIKDLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVSPDYGTLADARRFIAEAHKRELRVITELVINHTSDQHP
WFQRARKAKPGSAARNFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHQVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDVTGSDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDSLYGYPSVNVETQSGDPHSLLNWTRRMLAVRKQSKAFGRGTLKM
LSPSNRRILAYTREYTGPDGKQEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSLPDFTTLVLKKRLEELLEAPSRT
TLEQEVLPNWLPKRRWFAGKDSAIDQARIAYGVRFGDPQHPVLLSEIEVTSAGRSERYQL
PFGLLAEEQINSALPQQLAMARVRRGRQVGLITDAFALDSFVRNVLLALQGATCLDSEQG
QIRFEATAQLAALGLGADAEVRYLSAEQSNSSVVVGGSLVLKLIRKVAGGIHPELEMGAF
LTAAGFAHISPLLGSVLRRDAQGEDHLLMIAQGYLNNQGDAWEWTQNNLERAIRDELAEA
MSEQEQHYNALGELQDFAGLLGQRLGEMHLLLAAPSDNPDFAPEHATAKDAQAWNQQVAE
QLERGLQLLQQHQAELAAGEQKLLGKLLQHKALILGHIQQLAKQLVGGVRIRVHGDLHLG
QVLVIKGDAYLIDFEGEPARPLAERRGKHSPYKDVSGVLRSFDYAAAMALEAPAVDGAQG
AAAGRRKVVTRYLAEARHAFVQAYRLATANLAHGWQDPAAADAALALFSLEKAAYELAYE
AENRPAWLPVPLHGLVGLLRELKPFSDIESGGEQS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacctcgccccacgacctttatcaaggacccgctctggtacaaggacgcg
gtgatctaccaggtgcatgtgaagtcctacttcgattccaacaacgacggaatcggcgat
tttcccgggctgatcgccaaactcgactacatcaaggacctgggggtcaacaccatctgg
ctgttgccgttctacccctcgccgcggcgtgacgacggctacgacatcgccgagtaccgc
ggggtcagccccgactacggcaccctggctgacgcccggcgctttatcgccgaggcccac
aagcgcgagctgcgggtgatcaccgagctggtgatcaaccacacctccgaccagcacccc
tggttccagcgggcacgcaaggccaagccgggttcggcggcgcgcaatttctacgtgtgg
tccgacgacgaccagaaatacgacggcacgcggatcatctttctcgacaccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgcttctactcccaccag
ccggacctcaacttcgacaacccccaagtgatgaaggccgtgctctcggtgatgcgctac
tggctcgacatgggcatcgacggcctgcgcctggacgccattccctatctgatcgagcgc
gatggcaccaacaacgagaacctgccggagacccaccaggtgctcaagcagatccgcgcc
gaaatcgacgccaactatccggaccgcatgctcctggccgaggccaaccaatggccggaa
gacacccagctgtactttggcgatgttacaggcagcgacggcgacgagtgccacatggcc
ttccactttccgctgatgccgcgcatgtacatggccctggcccaggaggatcgcttcccc
atcaccgacatcctgcgccagaccccggagatcccggccaactgccagtgggcgatcttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgaccgcgagcgcgactacctg
tggaactactacgccgccgaccgccgggcgcggatcaacctggggatccgccggcgcctg
gcgccgctgatggagcgtgaccggcggcgcatcgagctgctcaacagcctgctgctgtcg
atgcccggtaccccgaccctgtactacggcgacgagatcggcatgggcgacaacatctac
ctgggggaccgggatggcgtgcgtacgccgatgcaatggtccatcgaccgcaacggcggt
ttctcccgggccgacccggccagcctggtgctgccgccgatcatggattcgctgtacggc
tacccgtcagtcaacgtcgagacccagtccggcgatccccattcgctgctcaactggacc
cggcgcatgctggcggtgcgcaagcagtccaaggcctttggccgcggcacgctgaagatg
ctgtcgccgagcaaccgacggatcctggcctatacccgggaatacaccgggcctgacggc
aaacaggagatcatcctgtgcgtggccaacgtctcgcgtagcgcccaggccgcggagctg
gacctctcggcgttcgcgggcatggtgccggtggagatgctcggcgggaacgcctttccg
cccattggccagctgaatttcctcctgaccctggcgccctacggtttctactggttcgtc
ctggcggcggaaaaccagatgcccagctggcacgtggaaccggcccagagcctgccggat
ttcaccaccctggtgctgaagaaacgcctcgaagaattgctcgaagcgccatcgcgcacc
accctggagcaggaagtactgcccaactggctgcccaagcggcgctggttcgccggcaag
gacagcgccatcgaccaggcgcggatcgcctacggcgtgcgctttggcgacccgcagcac
ccggtgctgctcagcgagatcgaagtcaccagcgccgggcgcagcgagcgctaccagttg
ccgttcggcctgttggccgaagagcagatcaacagcgccttgccccagcaactggccatg
gcccgggtgcgtcgcgggcgccaggtggggctgatcaccgacgccttcgccctcgacagt
ttcgtgcgcaacgtgctgctggcgctgcagggcgccacctgcctggacagcgagcagggc
cagatccgtttcgaggccaccgcgcagctggcggcgctgggcctgggggccgacgccgag
gtgcgctacctgtcggcggagcaatccaacagctcggtggtggtgggcggcagcctggtg
ctcaagctgatccgcaaggtggcggggggcattcacccggaactggaaatgggcgccttc
ctcaccgctgccggctttgcccacatctcgccgctgctgggctcggtgctgcgccgcgat
gcccagggcgaagaccatctgctgatgatcgcccagggctacctgaacaatcagggcgat
gcctgggagtggacccagaacaacctcgagcgggcgatccgcgacgagctggccgaggcc
atgtccgagcaggagcagcactacaacgccctgggcgagctccaggatttcgccggcctg
ctgggccagcgcctgggggaaatgcacctgctgctggcggcccccagcgacaatccggat
ttcgctcccgagcacgccaccgccaaggatgcccaggcctggaaccagcaggttgccgag
caactggagcgcgggttgcaactgcttcaacagcaccaggccgaactcgcggcaggggag
cagaaattgctcggcaaattgttgcagcataaggcgctgatcctgggtcacatccagcaa
ctggccaaacagttggtggggggcgtgcggattcgtgtccacggcgacctgcacctgggg
caggtactggtgatcaagggcgatgcctacctgatcgacttcgagggcgagccggcccgg
cccctggccgagcgccgcggcaagcacagcccgtacaaggatgtcagtggggtcctgcgt
tccttcgactacgcggcggccatggccctggaggcaccggcggtggacggcgcgcaaggc
gcggcggcggggcggcgcaaagtggtcacgcgctacctggccgaggcgcgccacgccttt
gtccaggcgtatcggctggcgacggctaatcttgcccatggctggcaggacccggcggcc
gcggatgccgccctggcactgttcagcctggagaaggccgcctacgagctggcctatgaa
gcggagaaccgtcccgcctggttgcctgtgccattgcacggcctggtggggctgttgcgt
gaactgaaacccttttccgatattgagagtggtggagagcagtcatga

DBGET integrated database retrieval system