KEGG   Pseudomonas protegens CHA0: PFLCHA0_c33570
Entry
PFLCHA0_c33570    CDS       T02671                                 

Gene name
kinE1
Definition
(GenBank) sporulation kinase E
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
pprc  Pseudomonas protegens CHA0
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pprc01001]
    PFLCHA0_c33570 (kinE1)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pprc02022]
    PFLCHA0_c33570 (kinE1)
Enzymes [BR:pprc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PFLCHA0_c33570 (kinE1)
Protein kinases [BR:pprc01001]
 Histidine kinases
  NtrC family
   PFLCHA0_c33570 (kinE1)
Two-component system [BR:pprc02022]
 NtrC family
  Unclassified
   PFLCHA0_c33570 (kinE1)
SSDB
Motif
Pfam: HATPase_c HisKA Response_reg HATPase_c_2 Syntaxin_2 DUF4174
Other DBs
NCBI-ProteinID: AGL85127
UniProt: A0A2C9ENA2
LinkDB
Position
3762383..3763801
AA seq 472 aa
MDQLNNRRILLIDDTPSIHEDFRKILTPPEADDNGLDDLEAQLFGATTKPRQQPFELDSA
YGGEEGLAMVCQAQERQRPYALAFVDMRMPQGWDGAQTIERLWQQDPRLQVVVCTAYSDY
SWEELLERLQGHHRLLILKKPFDNIEVQQMANTLTSKWEMTARALLQMHHLEHLVQQRTE
DLRQAGAALQLEIDERKQLENQLVQSEKLASLGQLAAGVAHEINNPIGFVSSNLGSLAGY
LQQLDQMLSAYRQAEEAIAAPELRKHLQSLRESIDLDFLQQDIPVLIRESKEGIGRVAQI
VKDLKNFSRVDSDQQWQLASLQQGIDSTLNIVANELKYKADLVTDYQPLPEIECLPSQLN
QVVMNLVVNAAQAIGPERGTITLRNGVDGERVWLEVSDSGCGIDQEHLAKIFDPFFTTKP
VGQGTGLGLSLSYGIVKKHGGQISVQSQPGVGSTFRVELPIRQARQELPAQP
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggaccagttgaacaatcgccggatcctgctgatcgacgataccccgtcgatccacgag
gactttcgcaagatcctcaccccgcccgaggcagacgacaacggcctggatgacctggag
gcacagctgttcggcgccacgaccaagccccggcaacagccttttgaactggattcggcc
tacggcggcgaggaaggcctggccatggtctgccaggcccaggagcggcagcgtccctat
gccctggcgtttgtcgacatgcgcatgccccagggctgggacggcgcgcagaccatcgaa
cgcctctggcaacaggacccgcggctacaggtggtggtgtgcaccgcctactccgactat
tcctgggaagagctgctggagcgcctgcagggtcatcaccgcctgctgatcctgaagaag
ccctttgacaacatcgaagtccagcagatggccaacaccctgaccagcaagtgggaaatg
accgcccgcgcgcttttgcaaatgcatcacctggagcacctggtgcagcagcgcaccgaa
gacctgaggcaggccggggcggcgctgcaactggagatcgacgaacgcaagcagttggaa
aaccagctggtgcaatcggaaaaactggcctccctcgggcaactggccgccggggtcgcc
cacgaaatcaacaaccccatcggtttcgtgtcctccaacctcggcagcctggcaggctac
ctgcagcagctcgaccagatgctcagcgcctatcgccaggccgaagaagccatcgccgcg
ccggaactgcgcaagcacctgcagagcctgcgcgagagcatcgacctggacttcctccag
caggacattccggtactgatcagggagtccaaggaaggcatcggccgggtggcgcagatc
gtcaaggacctgaagaacttctcccgggtcgacagcgaccagcaatggcagctggcgagc
ctgcaacagggcatcgactcgaccctgaacattgttgccaacgaactcaagtacaaggcc
gacctggtcaccgactaccagccgttgccggaaatcgaatgcctgccctcccaactcaat
caagtggtgatgaacctggtggtcaacgcggcgcaggccataggccccgagcgcggcacc
attaccctgcgcaacggcgtggacggcgagcgggtctggctggaggtcagcgacagcggc
tgcggcatcgaccaggagcacctggccaagatcttcgaccccttcttcaccaccaagccg
gtgggccaggggaccggcctgggcctgtcgctgtcctacggcatcgtcaagaagcacggc
gggcagatcagcgtgcagagccagcccggcgtcggcagcacctttcgcgtggaactgccg
atccggcaggcgcgtcaggagttgcccgcacaaccctag

DBGET integrated database retrieval system