KEGG   Pseudomonas protegens CHA0: PFLCHA0_c33920Help
Entry
PFLCHA0_c33920    CDS       T02671                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
pprc  Pseudomonas protegens CHA0
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AGL85162
UniProt: A0A2C9ENB3
LinkDB All DBs
Position
complement(3803394..3804530)
Genome map
AA seq 378 aa AA seqDB search
MAAARSACGPRCPDTALPSGEHPAAMRRTTMSPCALLETRHASTQAVDLDQRLAFWEDYN
ASTLVGLKCNSYAEGGFAASQDNLQLSAMRLARIVGNEHVVERDTSMIRGVPKESIFVSL
VTGSGSFFYQDGACQVLEPGELVVYRTDKPYLFGFSGAMRQFIFDIPQQQFAERCLKRFD
RPLRISVESGVQRLLLRTLGERTRGFFQQPLCAEAEAYQEQAFELLASIIAGHVGERPIN
ALSASYLLAAKQCIHEQLADPTLSCERVAAQTGISTRHLARLFALEETLPSRFILEKRLQ
QARQLLCSSQGAGLDISEIAYRHGFASQAHFARAFKSRFQQTPSEARALGLAATLASPAA
ESVGHACGDNLRGLEQGN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcccgcagtgcctgcggccccaggtgtccggacactgccttgccgtccggg
gaacatcccgccgccatgagaagaacaacaatgtctccatgcgccttgctcgaaacccgg
catgccagcacccaggccgtcgacctggaccaacgcctggccttctgggaggactacaac
gccagcaccctggtggggctcaagtgcaactcctacgccgagggcggtttcgccgccagc
caggacaacctgcaattgagcgccatgcgcctggcccgcatcgtcggcaacgaacacgtg
gtggagcgcgacacctcgatgatccgcggcgtgcccaaggagtcgatcttcgtgtccctg
gtcaccggcagcggctcgttcttctaccaggatggcgcctgccaggtgctggagccgggg
gagctggtggtctaccgcaccgacaagccctatctgttcggcttttccggggccatgcgc
cagttcatcttcgacattccccagcagcagttcgccgaacgctgcctgaaacgcttcgac
cggcctttgcggatcagcgtcgaaagcggggtccagcgcctgttgctgcgcaccctgggc
gaacgtacccggggctttttccagcaacccctgtgcgccgaggccgaggcttatcaggag
caggccttcgagcttctggccagcatcattgccgggcatgtgggggaacggccaatcaac
gccctgagcgcctcctacctgctggcggccaagcaatgcatccatgaacagctggccgac
ccgaccctgagctgcgagcgggtggcggcccagaccggcatttccacccggcacctggcc
cggctgttcgccctggaagaaacgctacccagccgcttcatcctggaaaaacgcctgcaa
caggcccgtcaactgctgtgcagcagccagggagcgggcctggatatcagcgagatcgcc
taccggcacggctttgccagccaggcgcattttgcccgggccttcaagagccgcttccag
caaacccccagtgaggcacgcgccctggggttagccgcaaccctggcaagcccggcagcc
gaaagcgtcggtcacgcctgtggcgacaatctccggggcctggagcaaggcaactga

DBGET integrated database retrieval system