KEGG   Pseudomonas protegens CHA0: PFLCHA0_c33930Help
Entry
PFLCHA0_c33930    CDS       T02671                                 

Gene name
dad
Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase Dad
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PFLCHA0_c33930 (dad)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PFLCHA0_c33930 (dad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGL85163
UniProt: A0A2C9ENC3
LinkDB All DBs
Position
3804767..3805300
Genome map
AA seq 177 aa AA seqDB search
MPEAAHREFWKDLQPIANCFKPDAKPEVYLPDAASDDLSLYVPFTETVSSRPLWISPSEN
RWCDILLARSAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATAGDFVYETPGEGHTLVAY
EHEQPMRVFFIVKGPLIWLDEQGEPDGYFDVHSYIAMCRAHYEKIGLGAAHIDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgcccaccgtgaattctggaaagacctgcaaccgatcgccaactgcttc
aagcccgacgccaagccggaggtctacctgcccgacgccgccagcgacgacctgagcctg
tacgtgcccttcaccgagaccgtgtcctcacggccactgtggatctcccccagcgaaaac
cgctggtgcgacattctcctggcccgcagcgccgggctggtgaaccgccactaccacccc
cacgaagtcttcgcctacaccctgtccggcaaatggggctacctggagcacgagtggacc
gccaccgccggggacttcgtctacgagaccccgggcgaaggccacaccctggtggcctat
gagcatgagcagccgatgcgggtgttcttcatcgtcaagggcccgctgatctggctcgac
gaacagggcgagcccgacggctacttcgacgtgcactcctacatcgccatgtgccgcgcc
cactacgaaaagatcggcctgggcgccgcccatatcgacaccctgttccgctga

DBGET integrated database retrieval system