KEGG   Pseudomonas protegens CHA0: PFLCHA0_c33940Help
Entry
PFLCHA0_c33940    CDS       T02671                                 

Gene name
exuT1
Definition
(GenBank) hexuronate transporter ExuT
Organism
pprc  Pseudomonas protegens CHA0
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Nuc_H_symport MFS_1_like LacY_symp
Motif
Other DBs
NCBI-ProteinID: AGL85164
UniProt: A0A2C9ENC7
LinkDB All DBs
Position
3805335..3806615
Genome map
AA seq 426 aa AA seqDB search
MAYKNNKAGYENTLLGVLFLTFGFVFFDRLALSFLFPFMADELQLSNSHLGMLSSILALA
WAVSGALVGAWSDRRGVRKPLLIVAVILFSLCSALSGLVTGFLSLLLFRAIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPVLIALAEAYGWRHAFIISLIPG
LLIALLIWRYVQPDPPRHEPRAHTPSSPGGSHRLALLKSRNIVLCTLISCVFLTWFIILI
SFTPTFLVKVRDYSPASMGTVMSCLGGAWVLWGFGVPAISDRLGRRPTLVLFSLIAACCP
IALLYASSPWMLGVLMLLTYTGLGCFTLFMATIPAETVPREVMATALGMIMGIGELVGGF
IAPTIAGFAADRFGLSIVMWMSCGGALLAAVLALFLKETAPAVLARQQRRHPGPNPAPSP
SLGGNP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaaaacaacaaggccggttacgagaacaccttgctgggggtgctgttcctg
accttcggtttcgtctttttcgatcgtctggcgctgtccttcctgttccccttcatggct
gacgagttgcaactgagcaacagccacctgggcatgctgtcgtcgatcctggccctggcc
tgggcggtgtccggggccctggtgggtgcctggtcggaccgccggggcgtgcgcaagccg
ttgctgatcgtcgcggtgatcctgttttccctgtgctcggcgctgtccgggctggtcacc
ggctttctcagccttttgctgttccgcgccatcatggggctggccgaggggccgatcctg
ccgctctcccaatcgctgatggtggaagcctcctcgccccatcgccggggcctgaacatg
ggcctgctgcaagggtcggcggcgggcctgttgggcgcggtgatcggcccgccggtgctg
atcgccctggccgaagcctacggctggcgccacgccttcatcatttcgctgattcccggg
ctactgatcgccctgctgatctggcgctacgtgcagcccgacccaccgcgacacgaaccg
cgagcgcacaccccgtccagcccgggtggcagccatcgcctggccctgctcaagagccgc
aacatcgtgctctgcaccctcatcagctgcgtgttcctgacctggttcatcatcctgatt
tccttcaccccgaccttcctggtcaaggttcgcgactacagcccggccagcatgggcacg
gtgatgagctgcctgggaggcgcctgggtgctctggggcttcggcgtgccggcaatctcc
gaccgcctcggccggcgcccgaccctggtgctgttctcgctgattgccgcttgctgtccc
atcgccctgctctacgcctcgtcgccctggatgctcggggtgctgatgctgctgacctac
accggcctgggctgcttcaccctgttcatggccaccatccccgcggaaaccgtgccccgc
gaagtcatggccacggccctgggcatgatcatgggtatcggcgagctggtgggcggcttc
atcgctccgaccattgccggcttcgccgccgaccgcttcggcctgtcgatcgtcatgtgg
atgtcctgcggcggcgcattgctggccgccgtgctggccctgttcctcaaggaaaccgcc
cccgcggtactggcccgccaacaacgccggcaccccggccccaaccctgcacccagcccg
agcctgggaggaaacccatga

DBGET integrated database retrieval system