KEGG   Pseudodesulfovibrio profundus: DPRO_1567Help
Entry
DPRO_1567         CDS       T05258                                 

Gene name
pbp
Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00550  Peptidoglycan biosynthesis
pprf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DPRO_1567 (pbp)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DPRO_1567 (pbp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pprf01011]
    DPRO_1567 (pbp)
Enzymes [BR:pprf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DPRO_1567 (pbp)
Peptidoglycan biosynthesis and degradation proteins [BR:pprf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DPRO_1567 (pbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Prot_ATP_ID_OB
Motif
Other DBs
NCBI-ProteinID: SOB58465
UniProt: A0A2C8F7U6
LinkDB All DBs
Position
DPRO:complement(1599598..1601466)
Genome map
AA seq 622 aa AA seqDB search
MSNLYSNADQTPPQSGLLLLQILILALFCLFSVRLWYLQIHRGEEYARKAKENQLRQEHI
FSPRGLIRDRNGDLLAVNEPAYALGLVREDCPDIDQTLHQVARWTDLSFEELKETYNKKR
RRVKPFEPLILVSDLSFHQLALIDANKLRWPGLEVQVRPRRQYRYGKLMAHVLGYVAEAN
EREMAKNPELALGDTVGKQGIEFVLEDRMRGVKGLSQFEVDVTGRRLQERILKHPRAGHE
VSLSIDLGLQKVAMDWLEEQAGGVVVMDADTGQIWALATSPSYDSNDFSSGLTPEQWAEL
RDDPLHPMQNRVIQSVYPPGSVFKHVVAGAGLHYDMLDPSETVNCTGQMKLGRRVFRCWK
KWGHGKVDLETALVQSCDVYFYRMGKKLTVDRMSEFAQASGFGKLTGIRLPHEKAGVMPT
REWKQRRFNESWQGGDNLNMSIGQGYTLVTPLQVARFFAGVINGGKLLKPLLLKDEKTVV
QGTIPLDQKQLDLLHDALVETVDSNRGTARRIRTPGVVVGGKTGTTQVVRLTDELKELDD
DDIPYRFRDHAWMSAIAEKDGRRFSIAVLVEHGLHGSSGAGPVVKAVIDYLFLDKVRKNP
ESRKAKARQARELKVPEKKNAN
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacctttatagcaatgctgaccagacgccgccccagagcggccttcttctgctc
cagattctgatccttgcgctgttttgtctgttttccgtccggctgtggtatctgcaaatc
caccggggcgaggaatacgctcgtaaggccaaagaaaaccagcttcgtcaggaacatatt
ttttcaccgcgtggcttgattcgcgatagaaacggcgacctgttggcggtcaatgaacct
gcctatgcccttgggctggtgcgggaagattgccccgatatcgaccagaccctgcatcag
gtggctcgctggaccgatttgtcctttgaggaactcaaggagacctacaataaaaaacgc
cgacgggtgaagccgttcgagccgctgattctggtctctgatctttcctttcatcagctt
gcgcttattgatgccaataaactccgctggcccggacttgaggtccaggttcgacccaga
agacaatatcgctatggcaagctcatggcgcatgtgctcggatatgtagctgaagccaac
gagcgcgaaatggcaaagaatcccgaactcgctctcggtgataccgtgggcaaacaggga
attgagtttgtccttgaagaccgcatgcgtggcgtcaagggcctaagccagttcgaggtc
gatgtcactggccgtcgtttgcaggaacgcattctcaaacaccctagggccggtcacgag
gtttctctgtccatcgatctggggctgcagaaagtggccatggactggcttgaagagcag
gcaggcggtgtcgtcgtcatggacgccgatacagggcagatttgggcattggccacctcg
ccgtcatatgattccaatgatttttcttccgggctgacgccagaacagtgggccgagctc
agagatgatccgctacaccccatgcagaaccgtgtcattcagtccgtctatcctcccgga
tccgtatttaagcacgtggtggctggggccggattgcactacgatatgctcgatcccagt
gaaacagtgaattgtaccggccagatgaagctgggacgacgcgttttccgttgctggaaa
aaatggggccacggcaaggtcgatctcgaaacggcattggttcagtcctgtgacgtatat
ttctatagaatgggaaaaaagctgaccgttgaccgcatgtccgaatttgcacaagcatct
ggtttcggcaagctgacaggaatccgtttgccacatgagaaggccggagtcatgcccacg
cgtgagtggaaacagcgccgattcaacgaaagttggcaaggaggtgacaacctgaatatg
tccattgggcaagggtatacgcttgttaccccgttgcaggttgctcgattcttcgctgga
gtcatcaacggtggaaagttgttgaaaccgctgctgctgaaagatgaaaagaccgttgtt
cagggaaccataccgcttgatcagaaacagctggatctgctccatgacgcattggtggaa
accgtggacagcaaccgtggtactgcgcggcgtattcgtactcccggtgtcgtggttggt
ggcaagacgggaacgactcaggttgtgcgtttgaccgatgaactcaaggagctggatgac
gatgacatcccctacagatttcgtgatcacgcatggatgtcagccattgctgaaaaagat
ggtcgtcgattttccattgccgtgcttgtggagcatggtctccatggctcatccggtgct
gggccggttgtcaaagcggtcatagattacctgttcctggacaaggtccgtaaaaatcct
gaatcgcgcaaagccaaagctcgccaggcgcgagaactgaaagtgccggagaaaaagaat
gccaattga

DBGET integrated database retrieval system