KEGG   Pseudodesulfovibrio profundus: DPRO_2700Help
Entry
DPRO_2700         CDS       T05258                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00550  Peptidoglycan biosynthesis
pprf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DPRO_2700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DPRO_2700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pprf01011]
    DPRO_2700
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pprf03036]
    DPRO_2700
Enzymes [BR:pprf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DPRO_2700
Peptidoglycan biosynthesis and degradation proteins [BR:pprf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DPRO_2700
Chromosome and associated proteins [BR:pprf03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    DPRO_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PASTA HTH_11 GntR Gemini_mov HTH_22 HTH_7 HTH_8
Motif
Other DBs
NCBI-ProteinID: SOB59609
UniProt: A0A2C8FBR6
LinkDB All DBs
Position
DPRO:complement(2784887..2786845)
Genome map
AA seq 652 aa AA seqDB search
MAKGSQGRKDLSKVKIGLVMVLFAVALVGLWARTGWVQLHDGSALLSKASKQSHAAEYEF
GERGRIFDRNGAMLATSVEAKSVYARPFQIENIDVAADTLSRDLKISRRTVYRKLKSKKK
FVWIKRQVTDRETAAIERADLKGISLLSEYSRIYPNGHLSGQLLGFVNIDGQGLEGIERI
YNERMKPGKAEYVVQRDAKGGRMYLDAQGREMDINGLDIRLTIDTHIQHAAEQALATSIE
KYQARAGIVMVVDVDSGDILAMANYPFFNPNAVSKSTASQRRLRAITDVYEPGSTMKPFL
FAAALEEGVIEPDTLINCENGRWRVGGKTIRDTHPEKWLPAHKVMRYSSNIGTAKIGLDL
GAGVYHSYLSRLGFGEKTNIGLQGETRGIMMPPDKWTSVDLAAISFGQGIGTTAIQMAKG
FLTLANGGVTKDLRLIKSPEKARKNNAEQIFSQQTADTVLSMMKDVVHEDGTGRRARIAG
ITMAGKTGTAQKAAKGGYGDQYLSSFVALVPALDPELLVITMVDEPQKSNYGSMVAAPVC
REVTVRTLAYHGKLSETLDTAVAENISVESLVEHPLEQSMDAPRQQPMTDRVPDFRQLPV
RRALELLVKKGIVPVIKGQGMTVKRQEPAAGQPWPDDANKEGTDDVFVLWLS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggcagccaagggcgcaaagatctcagcaaagtgaagattggactggtaatg
gtcctcttcgctgttgcgcttgtgggtctttgggccaggacaggatgggtgcaactgcac
gatggcagcgcccttctgagcaaagcatcgaaacaaagccatgccgctgaatatgaattc
ggcgagcggggccgtattttcgatcgcaacggagcgatgcttgccaccagtgtggaggca
aaatccgtctatgcgcgtcctttccagatagaaaatatcgatgttgccgccgacaccctg
tctcgtgatctgaaaatttcacgccgcacagtctaccgcaaactcaaatccaagaagaaa
ttcgtctggataaaacgacaggtgaccgacagggaaactgcggccatcgaacgcgccgat
ctcaagggcatcagcctcctcagtgaatattcccgcatctaccccaatgggcacctgtcc
ggtcaacttctcggcttcgtcaatatcgacggtcagggcctggaaggtatcgagcgaatc
tacaacgagcgcatgaagcccggcaaagccgaatatgtggtccagcgcgacgccaagggc
ggtcggatgtacctcgacgcccagggccgcgagatggacatcaacggtctcgacattcga
ttgaccatcgacacacacatccaacatgccgctgaacaggcgctggcaacctccattgag
aagtatcaggccagagccggtatcgtcatggtggtggacgtggattccggcgacatcctt
gccatggccaactacccgttcttcaatccgaacgcggtctccaaatccacagcgtcacag
cgccgcctgcgcgccatcaccgatgtgtacgaacccggctccaccatgaagccgtttctt
tttgccgctgcactcgaagaaggcgttatcgaaccggatacgctcatcaactgcgagaat
ggtcgctggcgggtcggaggcaagaccatccgcgacacccacccggaaaaatggctcccg
gcccataaggtcatgcgctactcctccaacatcggtaccgcgaagatcggtttggatctc
ggcgctggcgtctaccattcctacctttcccgcctcggatttggtgaaaagaccaacatc
gggcttcagggcgaaacccgcggcatcatgatgccgccggacaagtggaccagcgtcgat
ctggccgccatcagctttggtcagggcatcggtactacggccatccagatggcaaagggt
tttctcactttggccaatggcggcgtcaccaaagacctccggttgatcaaatcaccggaa
aaagctcgtaaaaacaacgcagagcagattttcagccaacagaccgctgacacggttctt
tccatgatgaaagacgttgttcacgaggacggcaccggccgcagagcacgcatcgcaggc
atcaccatggccggtaaaaccggcaccgctcaaaaagcggccaagggtggttacggcgat
caatatctttcttccttcgtcgcattggttcccgctctggacccggaactcctggtgatc
accatggtcgatgagccgcagaaatccaactacggctccatggttgccgctcccgtctgc
cgggaagtgaccgtgcgcacactggcctatcacggcaagctctcagagacccttgatacg
gcagtggcagagaatatttccgtagaatcccttgtcgagcaccctctggaacaatccatg
gatgctccgagacagcaaccaatgacggatcgtgttccggatttcagacagcttcccgta
cgccgggcgctggagttgctcgtcaaaaaagggatagtcccggtcatcaagggccagggc
atgacagtcaaacggcaggaacccgctgcagggcaaccatggccggatgacgcaaataag
gagggaacggatgatgtttttgttctctggctctcctag

DBGET integrated database retrieval system