KEGG   Pseudodesulfovibrio profundus: DPRO_2843Help
Entry
DPRO_2843         CDS       T05258                                 

Gene name
trpG
Definition
(GenBank) Anthranilate synthase component 2
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pprf01100  Metabolic pathways
pprf01110  Biosynthesis of secondary metabolites
pprf01130  Biosynthesis of antibiotics
pprf01230  Biosynthesis of amino acids
pprf02024  Quorum sensing
Module
pprf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DPRO_2843 (trpG)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    DPRO_2843 (trpG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DPRO_2843 (trpG)
Enzymes [BR:pprf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DPRO_2843 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: SOB59753
UniProt: A0A2C8FCG0
LinkDB All DBs
Position
DPRO:complement(2924304..2924876)
Genome map
AA seq 190 aa AA seqDB search
MFLLIDNFDSFTFNLVQAFQQLGADPVVIRNDREKVLELATDPQLERVCLSPGPSNPENA
GFCLEFLARLPQSMPVLGVCLGHQTLGHFAGAPVERAERIMHGKTSMVYHEGQGVFAGLD
SPFEVCRYHSLVVPAEKAADTIDVTARTERGEIMGLQYKDRPWHGVQFHPESILTPDGPK
LLQNFLNVKG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgctgatagataatttcgattccttcaccttcaatctggtgcaggcattccag
cagttgggcgctgatccggtcgttattcgcaacgaccgcgaaaaagtgctggaactggcg
accgatccacaactggagcgcgtctgcctctctcccggcccgtccaacccggaaaacgcc
gggttttgcctggagttcctcgcccggctgcctcaatcgatgccggtgctgggcgtttgc
ctcggtcaccagaccctcgggcattttgccggagcgccagtggagcgggccgagcggatc
atgcacggcaagacatccatggtctaccacgaaggacagggcgtctttgccggactcgat
tcgcctttcgaggtgtgccgctatcactcgctggtggttccggctgaaaaggcagccgac
accattgatgtaacagctcgcaccgagcgcggcgaaatcatgggccttcagtacaaggac
cgtccatggcacggtgttcagttccacccagaatccattctgacaccggacggaccgaaa
ttactgcaaaacttcctgaacgtgaaaggataa

DBGET integrated database retrieval system