KEGG   Pseudodesulfovibrio profundus: DPRO_2884Help
Entry
DPRO_2884         CDS       T05258                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00520  Amino sugar and nucleotide sugar metabolism
pprf01100  Metabolic pathways
pprf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DPRO_2884
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DPRO_2884
Enzymes [BR:pprf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DPRO_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: SOB59794
UniProt: A0A2C8FB69
LinkDB All DBs
Position
DPRO:complement(2962611..2963717)
Genome map
AA seq 368 aa AA seqDB search
MRTYLTAFLLIITIIAPATAHSQDEELDIMIGQMLMVGFRGYSAPEDAPVIRDITQYHVG
GVILFDKDMSRWYNRKRNIRSPKQVASLTESLQSAADIPLFIAVDQEGGNVQRLKAKYGF
PPTPSAQTLGSQDDAAVHKAARSIASTLDAAGFNMNFSPVADVNVNPNSPAIGKIGRSFS
SDPSRVTRCNAIFLEAFAQQGIVGSLKHFPGHGSAGADSHYGVTDVTNTWSESELIPYRT
LIGNGSVQMIMTAHIFNGKLDPIYPATLSKAIITGLLRERLGFNGVVITDDMDMRAITDA
FGRAKAIQLAIEAGADILLFGNNITFDEDVAPTAHGIIKELVETGVIPRKRISRSYDRIM
RLKNTLKQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacatacctgaccgcttttctgctcatcatcacgatcatcgcgcccgccactgcc
cattcgcaggacgaggagcttgatatcatgatcggacagatgctcatggtcggatttcgc
ggctactcggcaccggaggatgcaccggtaattcgtgatatcacgcaataccatgtgggc
ggcgttattcttttcgataaagacatgtcccgctggtacaacaggaaacgcaatatccgc
agccccaaacaggttgcctcacttactgaatccttgcagtcggccgcagatatcccgctg
tttatcgccgtggatcaggaaggcggcaatgtgcaacgcctcaaagccaaatacggattt
cccccaacaccttcggcccagacactcggcagtcaggacgatgctgccgtccacaaggca
gccaggtccatagcatccacactcgacgccgccggattcaacatgaatttctctccggtc
gcggatgttaacgtcaacccgaacagtccggccatcggcaagataggcaggagcttttca
tccgacccgagtcgcgtaacacgctgcaacgccattttcctcgaggcgttcgcgcagcag
ggaatagttggcagcctgaaacattttcccggccacggaagcgcaggagcagacagccac
tacggcgtaaccgacgtcaccaacacatggtcagaatccgaattgatcccgtatcgcaca
ttgatcggtaacggctcagtgcagatgatcatgaccgcccatattttcaatggaaagctc
gaccccatctatccggcgactctttcaaaggccatcatcacgggtcttttgcgggaacgt
ctcggattcaacggcgttgtcatcaccgatgatatggacatgcgcgccataaccgatgca
ttcggccgagccaaagccatccaactcgccatcgaagccggggccgacatcctgcttttc
ggcaacaacatcacctttgacgaggatgttgctcccaccgcacatggaatcataaaggaa
ctggtcgaaaccggcgtcatcccacgcaaacggatcagccgttcctatgaccggatcatg
cgcctgaagaatacgctgaaacaataa

DBGET integrated database retrieval system