KEGG   Pseudodesulfovibrio profundus: DPRO_3559Help
Entry
DPRO_3559         CDS       T05258                                 

Definition
(GenBank) putative alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00500  Starch and sucrose metabolism
pprf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DPRO_3559
Enzymes [BR:pprf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DPRO_3559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: SOB60475
UniProt: A0A2C8FDE1
LinkDB All DBs
Position
DPRO:complement(3707961..3709160)
Genome map
AA seq 399 aa AA seqDB search
MISVCFYFQVHQPMRLNKEYSFFDIGRNHHYRDEAANREILLKVAHKCYLPANRMMLDLI
NEFQGKFRISYAITGVAMEQFQEFCPEVLDSFRELADTGCVEFIGETHYHSLAFLFSKKE
FKRQVKMHGRILEEFFGSKPTTFRNTELIYNNDLALEVEKMGYKAILAEGADQVLGWRSP
NYVYQPAGCSKLKALLKNYRLSDDVAFRFSDRNWDEWPVSTDKFANWVHAIAGNGEVVNL
FMDYETIGEHQWEDTGIFHFFRSLPRSILSHNDFIFQTPAEAATRLDPLAQLDVPYFTSW
ADLERDVTAWLGNHMQDQAIELAYALEDKVLATEDDDMIATWREMLTSDHFYYMCTKWFS
DGDVHKYFNPYDTPHQAFIVYMNALNDLALRLRESQTAS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatatccgtctgcttctatttccaggtccaccagcccatgcggttgaacaaggaatat
tccttcttcgacattggcaggaaccaccactaccgcgacgaagcggccaatcgggagatc
ctgcttaaagtggcacataaatgctacttgccagccaaccggatgatgctcgacctgatc
aacgaatttcaggggaaattccgcatctcgtacgccattaccggcgttgccatggagcag
ttccaggagttttgtccagaggtcctcgactccttccgcgaactggccgatacaggctgc
gtggagttcatcggcgagacccactaccattcgctggccttccttttttccaaaaaggaa
ttcaaacggcaagtgaagatgcacggcaggattctggaggaatttttcggttcaaaaccg
acgacattcagaaacaccgaactcatctacaacaacgacctcgccctagaggttgaaaag
atgggctacaaggccatcctggccgaaggtgcggatcaggtgctgggctggcgctctccc
aactacgtataccagcctgccgggtgctccaagctcaaggcgctgctcaagaactatcgt
ctttctgacgatgtggcctttcgcttctctgatcgaaactgggatgaatggccggtaagc
acggataagtttgccaattgggtacatgccattgcgggcaacggcgaggtggtcaatctg
tttatggattatgagaccatcggcgaacatcaatgggaagacaccggcattttccatttc
ttccgcagcctgccccgctcgattctctcgcataacgacttcatctttcagacccctgcc
gaagccgcaactcgcctcgaccccctggcccaactcgacgtcccgtacttcacctcctgg
gctgatctggaacgagatgtgacggcgtggctcggcaaccacatgcaggatcaagcgatt
gaactggcgtacgctcttgaagacaaggttctggcaaccgaggacgacgacatgatcgca
acgtggcgggagatgctcactagtgaccacttctattacatgtgtaccaagtggttttcc
gatggcgacgtgcacaaatatttcaacccgtacgacacgccgcaccaagcattcattgtc
tacatgaatgctctcaatgatctggcccttcggctgagagaatctcaaacggcgtcctaa

DBGET integrated database retrieval system