KEGG   Pseudomonas protegens Cab57: PPC_1185Help
Entry
PPC_1185          CDS       T03613                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00620  Pyruvate metabolism
ppro00680  Methane metabolism
ppro01100  Metabolic pathways
ppro01120  Microbial metabolism in diverse environments
ppro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPC_1185
  Energy metabolism
   00680 Methane metabolism
    PPC_1185
Enzymes [BR:ppro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PPC_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HTH_38
Motif
Other DBs
NCBI-ProteinID: BAO60532
LinkDB All DBs
Position
1328618..1331248
Genome map
AA seq 876 aa AA seqDB search
MTDIDARLREDVHLLGELLGNTIRDQYGEAFLDKIEQIRKGAKADRRGSPGAELSASLDQ
LSEDELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFEARVLPELLARLRAEGHSAD
ALARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTSAERGQIQERLQR
LIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADKALFEATGLHLPLES
APIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLYLRDIDHLAAELSMQQASPALV
ARAGDSAEPYRALLKQLRERLRATRNWAHAALSAAVPAGAEVLHNNRDLLEPLQLCYQSL
HECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHTSAMTEITDYLGLGRYEDWSE
EDRITFLMRELSSRRPLLPGYFKPSADTAEVLATCREIAGAPAASLGSYVISMAGAASDV
LAVQLLLKESGVLRPMRVVPLFETLADLDNAGPVMEKLLHMPGYRSRLQGPQEVMIGYSD
SAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGS
VAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPQPAWRHLMDELASD
GVRAYREVVRDNPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQT
RLMLPAWLGWEAALSKALARGEGDLLGQMREQWPFFRTRIDMLEMVLAKADADIARSYDE
RLVEAELLPLGEHLRDLLSQACAVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPLHLLQA
ELLARSRKQQAPQGSPVEQALLVSVAGIAAGLRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgatgcgcgcttgcgcgaagacgttcacctcttgggggaactgctgggc
aataccatccgcgaccagtacggggaggctttcctcgacaagatcgagcagattcgcaaa
ggcgccaaggccgatcgccggggctcgccgggggccgaattgagcgccagcctcgaccag
ttgagcgaggacgaactgctgccggtggccagggccttcaaccagttcctcaacctggcg
aacatcgccgagcagtatcagttgatccaccgccgcgacgagtcgcagccggcacccttc
gaggctcgggtgctgccggagctgctggctcgcctgcgggccgaagggcacagcgccgat
gctctggcccggcaactggggcgcctggaaatcgagctggtgctgaccgctcaccccacc
gaagtggcgcgccgcaccctgatccagaaatacgacgcgattgccgggcaactggcggcc
caggaccaccgtgacctcacgagcgccgagcgcgggcagatccaggagcgcctgcaacgc
ttgatcgccgaggcctggcacaccgaggaaatccgccggacccgacccactccggtggat
gaagccaagtggggctttgcggtgatcgagcattcgctgtggcaggcgatccccaattac
ctgcgcaaggccgacaaggccttgttcgaggccaccgggctgcacctgccgctggagtcg
gcgccgatccgctttgcgtcgtggatgggtggcgaccgtgatggcaaccccaatgtcacc
gctgcggtaacccgcgaagtgctgctgctggcgcgctggatggccgccgacctatacctg
cgggacatcgaccacttggcggccgagctgtccatgcagcaggccagcccggcgctcgtg
gccagggccggagatagcgccgagccttatcgggcgctgctcaagcaattgcgcgaacgc
ctgcgggccacccgcaactgggcccacgcggcgctcagcgcggcggtgccggcgggcgcc
gaggtgttgcacaacaaccgtgacctgctggagccgctgcagctgtgctaccagtcgttg
cacgagtgcggcatgggagtgattgccgacgggccgctgctcgactgtctgcgccgggca
gtgaccttcggtctgttcctggtgcgcctggatgtacgccaggattccagccggcatacc
tcggccatgaccgaaatcaccgattacctgggcctggggcgttacgaggactggagcgag
gaggatcgcatcaccttcctgatgcgcgaactgagcagccgtcggccgttgttgccaggc
tatttcaagccctcggcggacaccgccgaagtgctcgccacctgccgcgaaatcgctggt
gcgccagcggcgtccctgggttcctatgtgatttccatggccggcgcggcctccgatgtg
ctggcggtgcagttgctgctcaaggaatccggtgtgctgcggccgatgcgcgtggtgcct
ctgttcgagaccctggcggacctggacaacgccggcccggtgatggaaaaactgctgcac
atgccgggctatcgttcgcgcctgcaagggccgcaggaagtgatgatcggctactccgac
tcggccaaggatgccggcaccacggctgcggcctgggcccagtaccgggcccaggagcgg
ctggtggacatctgccgcgagcaacaggtggaactgctgctgttccacggccgcggtggc
accgtgggacgcggcggcggcccggcccacgcggccattctgtcgcagccgccgggttcg
gtggcggggcgtttccgcaccaccgagcaaggggaaatgatccgcttcaaattcggcctg
ccggacatcgccgagcagaacctcaacctctatctggccgcggtactggaggcgaccctg
ttgccgccgccgccaccgcagccggcctggcgtcacctgatggacgagctggccagcgat
ggcgtccgggcctaccgcgaggtggtgcgggacaatccgcagttcgtcgagtacttccgc
cagtccactccggaacaggagctgggccgcctgccgctgggcagccgcccggccaagcgc
cgtgccgggggcatcgagagcctgcgggccatcccctggatcttcggctggacccagacg
cgcctgatgttgcccgcctggctcggctgggaagcggccttgagcaaggccctggcccgt
ggcgagggcgacctgctggggcagatgcgcgagcaatggccgttcttccgcacccgcatc
gacatgctggagatggtgctggccaaggccgacgcggatatagcccgctcctatgatgag
cgcctggtggaggccgaactgttgccgttgggcgagcatttacgcgacctattgtcgcag
gcttgcgcggtggtcctgggcctgaccgggcagtcgcaactgctggcgcacagccccgat
accctggagttcatccgcctgcgcaacacctacctcgacccgctgcatctgttgcaggcc
gagcttctggcgcgctcgcgcaagcagcaagcgccgcaaggaagccccgtggaacaggcg
ttgctggtctccgtggccggtatcgccgctggcttgcgcaataccggctga

DBGET integrated database retrieval system