KEGG   Pseudomonas protegens Cab57: PPC_1923Help
Entry
PPC_1923          CDS       T03613                                 

Gene name
nasE
Definition
(GenBank) assimilatory nitrite reductase [NAD(P)H], small subunit
  KO
K00363  nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00910  Nitrogen metabolism
ppro01100  Metabolic pathways
ppro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PPC_1923 (nasE)
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     PPC_1923 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: BAO61270
LinkDB All DBs
Position
complement(2104585..2104902)
Genome map
AA seq 105 aa AA seqDB search
MNWLDICALEEINTLGSRIIKGPKGDIAIFRTSDDQVFALDDRCPHKGGPLSQGLIYGKR
VACPLHNWQIDLESGQAQAPDHGCAHQHLARVESGRVLLALQDAG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaactggctggatatctgcgccctggaagaaatcaacaccctgggctcgcgcatcatc
aagggccccaagggcgatatcgcaatttttcgtaccagcgatgatcaagtcttcgctctc
gacgatcgctgcccgcacaagggcgggccgctatcccaggggctgatctacggcaaacgg
gtagcctgcccgctgcacaactggcagatcgacctggaatcgggccaggcccaggcccca
gaccacggctgcgcccaccagcatctggcccgagtggaaagcggccgggtgctgctggcc
ctgcaggatgccgggtaa

DBGET integrated database retrieval system