KEGG   Pseudomonas protegens Cab57: PPC_2905Help
Entry
PPC_2905          CDS       T03613                                 

Definition
(GenBank) trehalose synthase/maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00500  Starch and sucrose metabolism
ppro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPC_2905
Enzymes [BR:ppro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPC_2905
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PPC_2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAO62252
LinkDB All DBs
Position
3199862..3203209
Genome map
AA seq 1115 aa AA seqDB search
MAKKPRPTTFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIKDLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVSPDYGTLADARRFIAEAHKRELRVITELVINHTSDQHP
WFQRARKAKPGSAARNFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHQVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDVTGSDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDSLYGYPSVNVETQSGDPHSLLNWTRRMLAVRKQSKAFGRGTLKM
LSPSNRRILAYTREYTGPDGKQEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSLPDFTTLVLKKRLEELLEAPSRT
TLEQEVLPNWLPKRRWFAGKDSAIDQARIAYGVRFGDPQHPVLLSEIEVTSAGRSERYQL
PFGLLAEEQINSALPQQLAMARVRRGRQVGLITDAFALDSFVRNVLLALQGATCLDSEQG
QIRFEATAQLAALGLGADAEVRYLSAEQSNSSVVVGGSLVLKLIRKVAGGIHPELEMGAF
LTAAGFAHISPLLGSVLRRDAQGEDHLLMIAQGYLNNQGDAWEWTQNNLERAIRDELAEA
MSEQEQHYNALGELQDFAGLLGQRLGEMHLLLAAPSDNPDFAPEQATAKDAQAWNQQVAE
QLERGLQLLQQHQAELAAGEQKLLGKLLQHKALILGHIQRLAKQLVGGVRIRVHGDLHLG
QVLVIKGDAYLIDFEGEPARPLAERRGKHSPYKDVSGVLRSFDYAAAMALEAPAVDGAQG
AAAGRRKVVTRYLAEARHAFVQAYRLATANLAHGWQDPAAADAALALFSLEKAAYELAYE
AENRPAWLPVPLHGLVGLLRELKPFSDIESGGEQS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacctcgccccacgacctttatcaaggacccgctctggtacaaggacgcg
gtgatctaccaggtgcatgtgaagtcctacttcgattccaacaacgacggaatcggcgat
tttcccgggctgatcgccaaactcgactacatcaaggacctgggggtcaacaccatctgg
ctgttgccgttctacccctcgccgcggcgcgacgatggctacgacatcgccgagtaccgc
ggggtcagccccgactacggcaccctggctgacgcccggcgctttatcgccgaggcccac
aagcgcgaactgagggtgatcaccgagctggtgatcaaccacacctccgaccagcacccc
tggttccagcgggcacgcaaggccaagccgggttcggcggcgcgcaatttctacgtgtgg
tccgacgacgaccagaaatacgacggcacgcggatcatctttctcgacaccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgcttctactcccaccag
ccggacctcaacttcgacaacccccaggtgatgaaggccgtgctctcggtgatgcgctac
tggctcgacatgggcatcgacggcctgcgcctggacgccattccctacctgatcgagcgc
gatggcaccaacaacgagaacctgccggagacccatcaggtgctcaagcagatccgcgcc
gaaatcgacgccaactatccggaccgcatgctcctggccgaggccaaccaatggccggaa
gacacccagctgtactttggtgatgtcacaggcagcgacggcgacgagtgccacatggcc
ttccactttccgctgatgccgcgcatgtacatggccctggcccaggaggatcgcttcccc
atcaccgacatcctgcgccagaccccggagatcccggccaactgccagtgggcgatcttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgaccgcgagcgcgactacctg
tggaactactacgccgccgaccgccgggcgcggatcaacctggggatccgccggcgcctg
gcaccgctgatggagcgtgaccggcggcgcatcgagctgctcaacagcctgctgctgtcg
atgcccggtaccccgaccctgtactacggcgacgagatcggcatgggcgacaacatctac
ctgggggaccgggatggcgtgcgtacgccgatgcaatggtccatcgaccgcaacggcggt
ttctcccgggccgacccggccagcctggtgctgccgccgatcatggattcgctgtacggc
tacccgtcagtcaacgtcgagacccagtctggcgatccccattctctgctcaactggacc
cggcgcatgctggcggtgcgcaagcagtccaaggcctttggccgtggcacgctgaagatg
ctgtcgccgagcaaccgacggatcctggcctatacccgggaatacaccgggcctgacggc
aagcaggagatcatcctgtgcgtggccaacgtctcgcgcagcgcccaggccgcggagctg
gacctctcggcgttcgcgggcatggtgccggtggagatgctcggcgggaacgcctttccg
cccattggccagctgaatttcctcctgaccctggcgccctacggtttctactggttcgtc
ctggcggcggaaaaccagatgcccagctggcacgtggaaccggcccagagcctgccggat
ttcaccaccctggtgctgaagaaacgcctcgaagaattgctcgaagcgccatcgcgcacc
accttggagcaggaagtactgcccaactggctgcccaagcggcgctggttcgccggcaag
gacagcgccatcgaccaggcgcggatcgcctacggcgtgcgctttggcgacccgcagcac
ccggtgctgctcagcgagatcgaagtcaccagcgccgggcgcagcgagcgctaccagttg
ccgttcggcctgttggccgaagagcagatcaacagcgccttgccccagcaactggccatg
gcccgggtgcgtcgcgggcgccaggtggggctgatcaccgacgccttcgccctcgacagt
ttcgtgcgcaacgtgctgctggcgctgcagggcgccacctgcctggacagcgagcagggc
cagatccgtttcgaggccaccgcgcagctggcggcgctgggcctgggggccgacgccgag
gtgcgctacctgtcggcggagcagtccaacagctcggtggtggtgggcggcagcctggtg
ctcaagctgatccgcaaggtggcggggggcattcacccggaactggaaatgggcgccttc
ctcaccgctgccggctttgcccacatctcgccgctgctgggctcggtgctgcgccgcgat
gcccagggcgaagaccatctgctgatgatcgcccagggctacctgaacaatcagggcgat
gcctgggagtggacccagaacaacctcgagcgggcgatccgcgacgagctggccgaggcc
atgtccgagcaggagcagcactacaacgccctgggcgagctccaggatttcgccggcctg
ctgggccagcgcctgggggaaatgcacctgctgctggcggcccccagcgacaatccggat
ttcgctcccgagcaggccaccgccaaggatgcccaggcctggaaccagcaggttgccgag
caactggagcgcgggttgcaactgcttcaacagcaccaggccgaactcgcggcaggggag
cagaaattgctcggcaaattgttgcagcataaggcgctgatcctgggtcacatccagcga
ctggccaaacagttggtggggggcgtgcggattcgtgtccacggcgacctgcacctgggg
caggtactggtgatcaagggcgatgcctacctgatcgacttcgagggcgagccggcccgg
cccctggccgagcgccgcggcaagcacagcccgtacaaggatgtcagtggggtcctgcgt
tccttcgactacgcggcggccatggccctggaggcaccggcggtggacggcgcgcaaggc
gcggcggcggggcggcgcaaagtggtcacgcgctacctggccgaggcgcgccacgccttt
gtccaggcgtatcggctggcgacggctaatcttgcccatggctggcaggacccggcggcc
gcggatgccgccctggcactgttcagcctggagaaggccgcctacgagctggcctatgaa
gcggagaaccgtcccgcctggttgcctgtgccattgcacggcctggtggggctgttacgt
gaactgaaacccttttccgatattgagagtggtggagagcagtcatga

DBGET integrated database retrieval system