KEGG   Pseudomonas protegens Cab57: PPC_3386Help
Entry
PPC_3386          CDS       T03613                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
ppro  Pseudomonas protegens Cab57
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: BAO62733
LinkDB All DBs
Position
complement(3779477..3780523)
Genome map
AA seq 348 aa AA seqDB search
MSPCALLETRHASTQAVDLDQRLAFWEDYNASTLVGLKCNSYAEGGFAASQDNLQLSAMR
LARIVGNEHVVERDTSMIRGVPKESIFVSLVTGSGSFFYQDGACQVLEPGELVVYRTDKP
YLFGFSGAMRQFIFDIPQQQFAERCLKRFDRPLRISVESGVQRLLLRTLGERTRGFFQQP
LCAEAEAYQEQAFELLASIIAGHVGERPINALSASYLLAAKQCIHEQLADPTLSCERVAA
QTGISTRHLARLFALEETLPSRFILEKRLQQARQLLCSSQGAGLDISEIAYRHGFASQAH
FARAFKSRFQQTPSEARALGLAATLASPAAESVGHACVDNLRGLEQGN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatgcgccttgctcgaaacccggcatgccagcacccaggccgtcgacctggac
caacgcctggccttctgggaggactacaacgccagcaccctggtggggctcaagtgcaac
tcctacgccgagggcggtttcgccgccagccaggacaacctgcaattgagcgccatgcgc
ctggcccgcatcgtcggcaacgaacacgtggtggagcgcgacacctcgatgatccgcggc
gtgcccaaggagtcgatcttcgtgtccctggtcaccggcagcggctcgttcttctaccag
gatggcgcctgccaggtgctggagccgggagagctggtggtctaccgcaccgacaagccc
tatctgttcggcttttccggggccatgcgccagttcatcttcgacattccccagcagcag
ttcgccgagcgctgcctgaaacgcttcgaccggcctttgcggatcagcgtcgaaagcggg
gtccagcgcctgttgctgcgcaccctgggcgaacgtacccggggctttttccagcagccc
ctgtgtgccgaggccgaggcttatcaggagcaggccttcgagcttctggccagcatcatt
gccgggcatgtgggggagcggccaatcaacgccctgagcgcctcctacctgctggcggcc
aagcagtgcatccatgaacagctggccgacccgaccctgagctgcgagcgggtggcggcc
cagaccggcatttccacccggcacctggcccggctgttcgccctggaagaaacactaccc
agccgcttcatcctggaaaaacgcctgcaacaggcccgtcaactgctgtgcagcagccag
ggagcgggcctggatatcagcgagatcgcctaccggcacggctttgccagccaggcgcat
tttgcccgggccttcaagagccgcttccagcaaacccccagtgaggcacgcgccctgggg
ttagccgcaaccctggcaagcccggcagccgaaagcgtcggtcacgcctgtgtcgacaac
ctccggggcctggagcaaggcaactga

DBGET integrated database retrieval system