KEGG   Pseudomonas protegens Cab57: PPC_3387Help
Entry
PPC_3387          CDS       T03613                                 

Gene name
dad
Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PPC_3387 (dad)
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PPC_3387 (dad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: BAO62734
LinkDB All DBs
Position
3780850..3781383
Genome map
AA seq 177 aa AA seqDB search
MPEAAHREFWKDLQPIANCFKPDAKPEVYLPDAASDDLRLYVPFTETVSSRPLWISPSEN
RWCDILLARSAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATAGDFVYETPGEGHTLVAY
EHEQPMRVFFIVKGPLIWLDEQGEPDGYFDVHSYIAMCRAHYEKIGLGAAHIDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgcccaccgtgaattctggaaagacctgcaaccgatcgccaactgcttc
aagcccgacgccaagccggaggtctacctgcccgacgccgccagcgacgacctgcgcctg
tacgtgcccttcaccgagaccgtgtcctcacggccactgtggatctcccccagcgaaaac
cgctggtgcgacattctcctggcccgcagcgccgggctggtgaaccgccactaccacccc
cacgaagtcttcgcctacaccctgtccggcaaatggggctacctggagcacgagtggacc
gccaccgccggggacttcgtctacgagaccccgggcgaaggccacaccctggtggcctat
gagcatgagcagccgatgcgggtgttcttcatcgtcaagggcccgctgatctggctcgac
gaacagggcgagcccgacggctacttcgacgtgcattcctacatcgccatgtgccgcgcc
cactacgaaaagatcggcctgggcgccgcccatatcgacaccctgttccgctga

DBGET integrated database retrieval system