KEGG   Pseudomonas protegens Cab57: PPC_3418Help
Entry
PPC_3418          CDS       T03613                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppro  Pseudomonas protegens Cab57
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PPC_3418
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PPC_3418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAO62765
LinkDB All DBs
Position
complement(3812924..3814489)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDIVSLSNQITLLDNGSDAR
KPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPDIRHVAIDGALFQAEVDERKVMAVPSVYLNGVNF
GQGRMGLEEILAKLDTGAVEKQAQKLNAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQATEGPKLAAALEEHVKQYDVDIMNLQRASALVPAKEVGG
LHEIQFESGASLKAKSVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLFSLPNVKVITSALTSEVKGDG
QKVTGLAYKDRDSGEFHTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcttacctggaacgggtcacccagccg
atcgagatcgtagcctccctcgacgacggtgcgaaatcccaggaaatgctcgcgttactc
aaagacattgtcagtctttccaaccagattaccttgctcgataacggcagcgacgcgcgc
aagccttcgttctcgttgaatcgcccgggaagtgatatcagcctgcgtttcgccggtatt
cccatgggccacgaattcacctccctggtgttggccttgctgcaagtgggtggtcatcca
tccaaggccagtgccgaggtgatcgagcagatccgctcgctcaagggcgagttcaatttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccgacatccgtcacgtggccatcgatggcgcgctgttccaggcc
gaagtcgatgaacgcaaggtcatggcggtgcccagtgtctacctcaatggcgtgaacttc
ggccaggggcgcatggggctggaggaaatcctcgccaagctcgacaccggtgcggtggag
aagcaggcgcagaaactcaacgccaaggaagccttcgacgtgctggtggtcggcggtggt
ccagcgggtgcttcggcagccatctatgccgctcgcaaaggcatccgtaccggtgtggct
gccgagcgtttcggtggccaggtgctggacaccatggcgatcgagaacttcatctcggtg
caggcaactgaagggccgaagctggccgccgccctggaagagcacgtcaagcagtacgac
gtggacatcatgaacctgcagcgggccagtgccctggtgccggccaaggaagtcggcggc
ttgcacgagatccagttcgaaagcggcgccagcctcaaggccaagtcggtgatcctggct
accggtgcccgctggcgcgagatgggcgtgccgggtgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgtgtggcggtgatt
ggcggcggcaactccggtgtcgaagcggccatcgacctggcgggtatcgtcagccacgtg
accctgctggagttcgacagcaagctgcgggcggatgcggtgttgcagcgcaagctcttc
agcctgcccaacgtcaaagtcatcaccagcgccttgaccagcgaagtgaagggtgacggc
cagaaggtcaccggcctggcctacaaggaccgtgattcgggcgagttccacacggtggac
ctggaaggcatctttgtgcagatcggcctgttgcccaacacagattggctcaagggcacc
gtcgagctgtcgcctcgtggcgagatcatcgtcgatgcccgcggcgagacttcgctgcct
ggggtatttgctgcaggtgacgtcaccacggtgccctacaagcagatcgtgatagccgtg
ggcgagggcgccaaggcttccctcagtgcattcgatcacttgatccgtacctcagcaccg
gcttga

DBGET integrated database retrieval system