KEGG   Pseudomonas protegens Cab57: PPC_4286Help
Entry
PPC_4286          CDS       T03613                                 

Gene name
pvdL
Definition
(GenBank) peptide synthase
Organism
ppro  Pseudomonas protegens Cab57
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: BAO63633
LinkDB All DBs
Position
complement(4789512..4802528)
Genome map
AA seq 4338 aa AA seqDB search
MTDAFELPSTLAQALQRRAVLAPDQVALRFLAEEQDQSVVLSYRDLDLRARTIAAALQAN
AEFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLISIMADAEPRLL
LTSAGLRDSLLQMDELKAAGAPQLLCVDTLQAGLAEDWQAVALQDDDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPAYFLARPVRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSGWRVAYSGSE
PIRLDTLERFAEKFSACGFSHENFLASYGLAEATLFVAGGVRGQGIPALHLDDQALAQNR
AEPGQGSAMMSCGFSQPEHAVLVMDPQQLGELPDNRIGEVWAAGPSIAHGYWRNPEATAK
TFVQHAGRTWLRTGDLGFIRDGELFITGRLKDLLIVRGHNLYPQDIEKTIEREVEVVRKG
RVAAFAVTEQGQEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQEAPSVVVLLNPGA
LPKTSSGKLQRSACRTRLADGSLDYYALFPQAGSATADAADSAGDALQTLIGRIWQEQLQ
CASVAADDHFFLLGGNSIAATQVIARLREELGLELGLRLLFEAPTLGAFSAAVARQQQDG
GVAQGSINALSRQQPLPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDEEALRASFQ
QLIQRHEALRTRFFERDGQALQQVDAAGEFNLQVIDISDLPPAEREARARQIREDEARTQ
FDLEKGPLYWATLVRLDDEEHQLLLTLHHIIADGWSLNLLIDEFSRLYAAAAQGHSLELA
PLALQYADYGSWQRQWLAQGEGQRQLDYWKQQLADEAPVLNLATDHPRSAQVRHSAARHD
LRLSASLSEAVRQTAQARQATPFMLLLAAFQTLLHRYSGQSDIRIGVPNANRPRLETQGL
LGFFINTQVLRGQLDSRQSFADLLQQTRRTTLEAQAHQDLPFEQLLEAFPEAREQGLFQV
MFNHQQRDLSTLRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLAFDYADELFDAA
SIQRLAGHFISLLEHACLQPDCALGDLPLLGNAEAAQLQQWSVAPCAPAEQWLPERLHEQ
LRQSPERTALVWDGGQLGFAELHAQASRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLA
IIKAGGAYVPLDPDYPAERLAYMLEDSGVGLLLTQTHLLGRMPEAPGVSAIAMDSLKLDS
WPSHAPGLHLHGEHLAYVIYTSGSTGQPKGVGNTHRALMERLQWMQDSYQLQADDVLMQK
APISFDVSVWECFWPLITGCRLLIAAPGEHRDPHRIAQLVQEYGVTTLHFVPPLLQLFVD
EPLSAECHSLRRVFSGGEALPAELRNRLLQQLPNAQLHNRYGPTETAINVTHWQCSVDDG
ERSPIGRPLGNVVCRVLDTDLNPLPAGVPGELCISGQGLARGYLGRPALTAERFVVDPLS
EEGARLYRTGDRVRWCADGVLEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGVAQAAVLV
RDTLAGPQLIGYYTPNAHDEDEQQQSARLKTALAAELPEYMVPAQLLRLDAMPLSPSGKL
DRRALPEPQWQVREHVEPSTELEQQIAAIWREVLGQPRIGLKDDFFALGGHSLLATQIIS
RTRQACDVELPLRALFEASELGAFAEQVLLIQQSGARNQQPPIARVDRSQPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARLSGVFDVGRFEAALQALILRHETLRTTFPSVNGVAHQQV
HADTGLRMAWKDFSALAPDARQQRLQQLADSEAHQPFDLETGPLLRACLVKAGEQEHYFV
LTLHHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQRQWLESGERQR
QLDYWTGQLGREHPLLELPSDRPRPAVQSHQGELYRFDLSDELAARVRAFNAEHGLTLFM
TMTAALSLLLYRYSGQSDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGQLL
EQIRHTVIEGQSHQDLPFDHLVEALQPPRSTAYNPLFQVMCNVQRWEFQQSRQLAGMTVE
YLVNDARATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALLSDPQR
RLCELPLLQADEQQHLLDSLSVEPGEQRLDQCIHHLFSEQALARRDAPALTFAGQTLSYS
ELDSRANRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRL
HYMIEDSGIGLLLSDARMFAALGELPAGVGRWCLEEDGALLADYPAGELPFISLPQHQAY
LIYTSGSTGQPKGVVVSHGEIAMHCQAVIRRFGMRPDDCELHFYSINFDAATERLLVPLL
SGAQVVLRAQGQWDAEEICQLIRQHRISILGFTPSYGSQLAQHLATQQQTLPVRMCITGG
EALTGEHLQRIRAAFQPNLFFNAYGPTETVVMPLASLAPQQLAEGVASVPIGSIVGARVA
YILDADLALVPQGATGELYVGGAGLAQGYHRRPGMSAERFVADPFATDGGRLYRTGDLVR
QCADGQLEYIGRVDHQVKIRGFRIELGEIETRLLDHPAVREAVVLAIDTPAGKQLAGYLV
SEVAEHNEVQQANLREALKQQLKTQLPDYMVPTHLILLGSMPLTANGKLDRRALPMPDPE
LNRQQYVAPSNELEQTLAGVWGEVLNVQQVGLNDNFFELGGDSILSIQVVSRARQLGIHF
TPRDLFQHQTVQTLARVASHTQRVSAEQGQLSGEAPLTPIQHWFFDSRIPQPQHWNQALL
LEPLGTLDASLLEQALLAVLEQHDALRLRFNRSGGQWRAEYLPLSDAPLLWQVRVPSMDT
CEALFADAQRSLDLEHGPLLRAVLVDGPEGEQRVLLAIHHLVVDGVSWRVLLEDLQNAYR
QLQAGQALNLPAKTSALRDWSSRLQAYAGSESLREELSWWQQQLAGPAAQLPGLNAAGSQ
QHQQARSHSVTLDAERTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSALVQLEGH
GREALFDEIDLTRTVGWFTSAYPLRLTPLQVEEAAGQGASIKAIKEQLRAVPHKGLGYGV
LRYLADASCREALAALPLAPVTFNYLGQFDQSFGADALLRPLDESVGPAHAPEAPLPNEL
SIDSQVYGGELVLRWTYSGERFDAELIGELASAYLGELQSLIAHCLKDDAGGLTPSDFPL
ARLTQAQLDGLPVPAAQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPER
FAQAWQAVVARHEALRASFCWNVGEDMLQVIHKPGRTPIEFLDWSAVPEAEQEAKLQALH
KQEREAGFDLLNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYTALGE
GREAQLAVPPRYRDYIGWLQHQSLSQARQWWRQNLEGFERTTPIPSDRPFLREHAGDSGG
MTVGDCYTRLDARDGAQLRELAQQHQLTINTFAQAAWALVLRRMSGDRDVLFGVTVAGRP
VDMPQMQRTVGLFINSIALRVKLPEEGQRCSVRQWLSGLLDSNMQLREYEYLPLVAIQET
SELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPITAVCYPGDDLGLH
LSYDQRYFEQATIERMLGEFKRLLLALMQGFHGDMAELPLLGEEEQDFLLAGCNQSEHEY
PLERSYVELFEAQVAAHPQRVAASCLDQRYSYAELNQCSNRLGHALIANGVGFDQPVALL
AERGLELLGMIIGSFKAGAGYLPLDPGLPSQRLGRIIELSRTPILVCSAACREQAQALLD
EFACAGRPRLLVWEELQAAGHAESNPGRYSAPDNLAYVIYTSGSTGLPKGVMVEQRGMLN
NQLSKVPYLQLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGLLAHV
EEQGITVLESVPSLIQGMLAQDVIVLDGLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAY
GPAECSDDVAFFRVDLASTRGAYLPIGTPTDNNRLYLMDEALELVPLGAVGELCVAGTGI
GRGYVSDPLRTALAFVPHPFGAAGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIE
LGEIEARLHEQPELRDAAVGVQEGVNGKHLVGYLVASDTNLSPSECLERIKPRLRAELPE
YMVPLHWLWLARLPLNANGKLDRKALPALEIGQLQSQDYQAPGNELEQTLADIWAEVLKV
ERVGVRDNFFELGGHSLLATQIASRVQKTLQRNVPLRAMFECSTVQELAAYIDGLGANEI
SEEKVDRLSDLMAELEGL
NT seq 13017 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgttcgaactccccagcaccctggcccaagcccttcaacgccgggcagtc
ctggcacctgatcaagtggcgttgcgctttctcgccgaagagcaggatcagagcgtggtc
ctcagttaccgggacctggacctccgtgcgcgcaccattgctgcggctctgcaagccaac
gccgaattcggtgatcgcgcggtattgctgtttcccagcggcccggactacgtcgcggcg
ttcttcggttgcctgtacgccggggtgatcgcggtgccggcctatccgccggagtccacc
cgtcgtcatcaccaggagcgcctgatttccatcatggccgacgccgagccacggttgctg
ctgaccagcgccgggctgcgggattcactgttgcagatggacgaactcaaggccgcgggc
gcgccgcaactgctgtgtgtggacaccctgcaagccgggctggccgaagactggcaggcc
gtggcgctgcaggacgacgacatcgccttcctgcaatacacctcgggctccaccgcgctg
cccaagggcgtgcaggtaagccatggcaacctggtggccaacgaactgctgatccgtcgc
ggctttggtatcgacctcaacccggacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcttaattggcggcctgctgcaaccgattttcagcggcgtgccctgtgtgctg
atgtcaccggcctacttcctggcgcggcccgtacgctggctggaagcgatcagcgaatac
ggcggcaccatcagcggcggcccggatttcgcctaccgcctgtgcagcgaacgggtcagc
gagtcggccctggagcgcctcgacctcagcggctggcgcgtggcctattcggggtccgag
ccgatccgcctggacaccctggagcgtttcgccgagaagttcagtgcctgcggtttcagc
catgaaaacttcctcgcctcctacggcctggccgaagccaccctgttcgtggccggtggc
gtgcgcggccagggcatcccggccctgcacctggacgaccaggccctggcgcagaaccgc
gccgagccggggcagggcagcgcgatgatgagctgcggcttcagccagccggaacacgcc
gtgctggtgatggatccgcagcaactgggcgaattgcctgacaaccgtattggcgaagtc
tgggccgccgggccgagcattgcccatggctactggcgcaatcctgaagccaccgccaag
accttcgtccagcatgccggtcgtacctggttgcgcaccggtgacctgggctttatccgc
gatggcgagctgttcatcaccgggcgcctgaaggacctgctgatcgtgcgcgggcacaac
ctctacccccaggacatcgaaaagaccatcgagcgcgaggtggaagtggtgcgcaagggc
cgggtggcggcgtttgcggtcaccgagcagggccaggaaggcatcggcatcgccgcggaa
atcagccgcagcgtgcagaagatcctgccccccgaggcgctgatcaaggccatccgccag
gcggtggccgaagcctgccaggaagcgccgagcgtggtggtgctgctcaaccccggggcc
ctgccgaaaacctccagcggcaagttgcagcgttccgcctgccgcacccggctggccgat
ggcagcctggattactacgcgctgttcccgcaggccggcagcgcaacagctgacgccgca
gacagtgccggtgacgcgctgcaaaccctgatcgggcgcatttggcaggagcaattgcaa
tgcgcttcagtggccgccgacgatcacttcttcctcctggggggcaactcgattgccgct
acccaggtgatcgcccgcctgcgtgaagagctggggctggaactgggcttgcgcctgctg
ttcgaggctccgaccctgggtgccttcagcgctgccgtggcgcgccagcagcaggacggc
ggcgtggcccagggcagtatcaatgccctgtcgcgccagcagccgctgccgcaatccctg
gcccagaaccgcctgtggatcacctggcaactggacccgcagagcagcgcctacaacatt
cccggcggcctgcgcttgcgtggcgagctggatgaagaggccctgcgcgccagcttccag
caactgatccagcgccacgaagcgctgcgcacgcgcttcttcgagcgtgacggccaggcc
ctgcaacaggtggatgccgccggcgaattcaacctgcaggtgatcgatatcagcgacctg
ccaccggccgagcgtgaagcccgggcgcggcagatccgcgaagacgaggcccggacccag
ttcgatctggagaaggggccgctgtactgggcgaccctggtgcgcctggatgacgaagaa
caccaactgctgctgaccctgcaccacatcatcgccgacggctggtcgctgaatctgctg
atcgacgagttctcgcggctctatgccgccgcggcccagggccatagcctggagctggcg
cccctggccctgcaatacgccgactacggcagttggcagcgccagtggctggcccagggc
gaaggccagcgccagctggactactggaaacagcagttggcggacgaagccccggtgttg
aacctcgccaccgaccacccgcgttcggcccaggtccgccacagcgccgcgcgccatgac
ctgcgcctgagcgcgagcctcagtgaagccgtgcgccagaccgcccaggctcggcaggcc
acgccgttcatgctgttgctggcggcgttccagaccctgctgcaccgctacagcgggcag
agcgatatccgcatcggtgtgcccaacgccaaccgcccgcgcctggaaacccagggcctg
ctgggctttttcatcaacacccaggtattgcgtgggcagttggattcgcgccagtccttc
gccgacctgctgcagcagacccgccgcaccaccctggaggcccaggcccaccaggacctg
cctttcgaacaattgctcgaagccttccccgaagcccgcgagcagggcctgttccaggtc
atgttcaaccaccagcagcgcgacctcagtaccttgcgccgcctgccggggctgctggcc
gaagagctgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaagag
gaccgcaacggccgcctgagcctggccttcgactacgccgacgagctgttcgacgcggcc
agcatccagcgtctggccgggcatttcatcagcctgctggagcatgcctgcctgcaaccg
gactgcgccctgggcgacttgccgttgctcggcaacgccgaagcggcgcaactgcagcaa
tggagcgtggccccctgcgcgccggccgagcagtggctgccggagcgcctgcacgaacaa
ctgcgccagagcccggaacgcaccgcgctggtctgggacggcgggcaactgggctttgcc
gaactgcacgcccaggccagccgcctggcccactacctgcgggacaagggcgtcgggccg
gacgtgtgcgtggccatcgccgccgaacgttcgccgcaactgctgatcggccttctggca
atcatcaaggccggtggcgcctacgtgcccctggacccggactaccctgccgaacgcctg
gcctacatgctcgaagacagcggcgtgggcctgctgctgacccagacccatctgctgggc
cggatgcccgaagccccgggtgtcagcgccatcgccatggacagcctcaagctcgacagc
tggccgagccacgcgccgggcctgcacctgcacggcgaacacctggcctatgtgatctac
acctccggttccaccggccagcccaagggcgtcggcaacacccatcgcgcgctgatggag
cgcctgcaatggatgcaggacagctaccagctgcaagccgacgatgtgctgatgcagaag
gctcccatcagcttcgacgtgtcggtgtgggagtgcttctggccgctgatcaccggctgc
cgcctgctgatcgccgcccccggcgagcaccgcgatccccatcgcatcgcccagctggtg
caggagtacggcgtcaccacgctgcacttcgtgccgccgctgttgcagttgttcgtcgat
gagccgctgagcgccgaatgccacagcctgcgccgggtgttctccggtggcgaagccctg
ccggccgagctgcgcaatcgcctgttgcagcagttgcccaatgcgcaactgcacaaccgc
tatggcccgaccgaaaccgcgatcaacgtcacccattggcagtgttcagtcgatgacggc
gagcgttcgcccattggccggcccctgggcaacgtggtgtgccgggtgctggacacggac
ctcaatccgttgccggcgggagttccgggtgagctgtgcatcagcggccagggcctggcc
cggggttacctgggacgcccggcgctgaccgccgaacgctttgtggtcgaccccctgagt
gaggagggcgcgcgcctgtaccgcaccggtgaccgcgtacgctggtgcgccgacggcgtg
ctggaatacctcggtcgcctcgaccagcaggtcaagctgcggggctttcgggtcgagccg
caggaaatcgaagcgcggctgctggcccaggacggcgtggcccaggccgcggtgctggtg
cgcgacaccctggccggcccgcagttgatcggctactacacgcccaatgcgcacgatgaa
gatgaacagcagcaaagcgcccggctgaaaactgccctggccgccgagctgccggaatac
atggtgccggcgcaactgctgcggctggacgccatgcccctgagccccagtggcaagctc
gaccgccgggccctgccggagccgcaatggcaggtgcgcgagcacgtcgaaccgagcacc
gaactggaacagcagatcgcggctatatggcgcgaagtgctgggccagccacgcatcggc
ctcaaggacgatttcttcgccctgggcgggcattcgctgctggccacccagatcatttcc
cgcacccgccaggcctgcgacgtcgagctgccactgcgggcgctgttcgaagctagcgaa
ctgggggcctttgccgagcaggtgctgctgatccagcagtccggcgcgcgcaaccagcag
ccgccgattgcccgggtagaccgcagccagccggtgccgctgtcctattcccagcagcgc
atgtggttcctctggcagatggagcccgacagcccggcctacaacgtcggtggcatggcg
cggctgtcaggggtgttcgacgtgggccgcttcgaggccgcgctgcaagcgctgatcctg
cgtcacgaaaccctgcgcaccaccttccccagcgtcaatggcgtggcccatcagcaggtg
catgccgacaccggcctgcgcatggcctggaaggacttctcggccctggccccggatgcg
cgtcagcagcgcctgcaacaattggcggacagcgaagcgcatcaacccttcgacctggag
accggccccttgctgcgcgcctgcctggtcaaggccggcgagcaggagcattacttcgtc
ctgaccctgcaccacatcgtcaccgaaggctgggccatggacatcttcgcccgcgagctg
ggcgcgctgtacgaagccttcctcgacgaccgcgaatcgcccctggaacccttgccggtg
cagtacctggactacagcgtgtggcagcgccagtggctggaatccggcgagcgccagcgc
cagctggactactggaccgggcaactgggccgcgaacacccgctgctggagctgcccagc
gaccggccacgcccggcggtgcaaagccaccagggcgaactctatcgcttcgatttgagc
gacgagctggcggcccgggtgcgggccttcaatgccgagcatggcctgaccctgttcatg
accatgaccgccgcgttgtcgctgctgctctatcgctacagcggccagagcgacctgcgc
atcggcgcgccggtggccaaccgcatccgcccggaaagcgaagggctgatcggcgccttc
ctcaatacccaggtgctgcgttgccagctcgacgggcagatgagcgtcggccagttgctg
gagcagatacgccacaccgtgatcgagggccagtcgcaccaggacctgccgttcgatcat
ctggtggaagccttgcaaccgccgcgcagcaccgcctacaacccgctattccaggtgatg
tgcaacgtccagcgctgggaattccagcaaagccggcaactggcgggcatgaccgtggaa
tacctggtcaacgatgcccgggccaccaagttcgacctcaacctggaagtcaccgacctg
gaccagcgcctgggctgctgcctgacctacagcaccgacctgttcgacgagccgcgcatt
gcgcgcatggccggccactggcgcaatctgctggaagccttgctcagcgacccgcaacgg
cgcctttgcgaattgccactgctgcaggccgatgaacagcagcacctgctggacagtttg
agcgtcgagcccggcgagcaacgtctggaccagtgcatccaccacctgttcagcgaacag
gccctggcccgccgcgatgccccggccctgaccttcgccgggcagaccctgagctacagc
gagctggacagccgcgccaaccgcctggcctggatgcttcgtgagcgtggcgtgggcccg
caggtgcgagtcggcctggccctggagcgttccctggaaatggtcgtcggcctgctggcg
atcctcaaggccggtggcgcctacgtgcccctggacccggaataccccctggaccgcctg
cactacatgatcgaagacagcggcatcggcctgctgctcagcgatgcgcggatgttcgcc
gccctgggcgagctgccggccggagtcggccgctggtgcctggaagaggacggtgcgctg
ctggccgactacccggcgggcgaattgcccttcatcagcctgccacagcatcaggcgtac
ctgatctacacctccggctccaccggccagcccaagggcgtggtggtgtcccatggggaa
atcgccatgcactgccaggcggtgatccgtcgtttcggcatgcgtccggacgattgtgag
ctgcacttctattccatcaacttcgacgccgccaccgagcgcttgctggtgccgctgctc
agcggcgcccaggtggtgctgcgggcccagggccagtgggacgccgaggaaatctgccag
ctgattcgtcagcatcgcatcagcatcctcggtttcactccgagctacggcagccagttg
gcccagcatctggcgacccagcagcagaccctgccggtgcgcatgtgcatcaccggcggc
gaggccctgaccggcgaacacctgcagcgcatccgtgcggccttccagccgaacctgttc
tttaacgcctacggccccaccgaaaccgtggtcatgcccctggccagcctggcgccgcag
cagttggccgaaggcgtggccagcgtgcccatcggcagcatcgtcggggcccgggtggcc
tatatcctcgatgccgatctggcgctggtgccccaaggggcgaccggtgagctgtatgtc
ggcggtgccggtctggcccagggttatcaccgtcgtccggggatgagtgccgagcgcttt
gtcgccgacccattcgccaccgatggcgggcgcctgtaccgcaccggggatctggtgcgc
cagtgcgccgacggccagctggagtacatcggccgagtcgatcatcaagtgaaaattcgc
ggcttccgcatcgagctgggggaaatcgaaacccgtctgctggatcatccggctgtgcgt
gaagcggtggtgctggctatcgacaccccggccggcaaacagctggccggctatttggtc
agcgaagtggccgagcacaacgaggtgcagcaggccaacctgcgcgaagccctcaagcag
cagctgaaaacccagctgccggactacatggtgccgacccacctgatcctgctcggcagc
atgccgctgaccgccaacggcaagctcgatcgccgagccctgccgatgcccgatccggag
ctcaatcgccagcagtatgtggcgccgagcaacgagctggaacagaccctggccggggtc
tggggcgaagtgctgaacgtgcagcaagtgggcctcaacgacaacttcttcgaactgggg
ggcgactcgatcctgtcgatccaggtggtcagccgcgcccgccagctggggattcatttc
accccgcgggacctgttccagcaccagaccgtgcagaccctggcgcgggttgccagccac
actcagcgcgtcagcgccgagcagggccagctcagtggcgaagcgccgctgacgccgatc
cagcactggttcttcgacagccgtattccccagccgcagcactggaaccaggccttgttg
ctggaaccgctgggcaccctggatgcgtcgttgctggagcaagccctgctggcggtgctg
gagcaacacgacgccctgcgcctgcgcttcaatcggtcgggcggacagtggcgtgccgag
tacctgccgctgtccgatgctcccttgttgtggcaggtgcgggtgccgtccatggacacc
tgcgaggcgctgttcgccgatgcccagcgcagcctcgacctggaacacgggccgctgctg
cgggcggtgctggtggacggccctgaaggcgagcaacgggtgttgctggccatccaccac
ctggtggtggacggtgtgtcctggcgcgtgctgctggaagatttgcaaaacgcctatcgt
cagttgcaagccggacaggccctgaacctgccggccaagaccagcgcgctgcgggactgg
tcgagccgcctgcaagcctatgccggcagcgaatccctgcgtgaagaactgagctggtgg
cagcaacaactggctggcccggccgcgcaactgccgggcttgaatgccgctggcagccag
cagcatcaacaggcccgcagccacagcgtgaccctggatgccgaacgcacccgccagttg
ctgcaacaggctccggcggcctaccgcacccaggtcaatgacctgctgctgaccgccttg
gcccgggtgctgtgccgctggagcgggcagccttcggccctggtgcaactggaaggccac
ggccgcgaggcgctgttcgacgagatcgacctgacccgcaccgtgggctggttcaccagc
gcctatccgctgcgcctgaccccgttgcaggtggaggaagcggccgggcagggcgcgtcg
atcaaggccatcaaggaacaactgcgggccgtgccgcacaagggcctgggttatggcgtg
ctgcgctacctggcagatgcaagctgccgcgaggccctggcggcgctgccgctggcgccg
gtgaccttcaactacctggggcagttcgaccagagctttggcgccgatgccttgctgcgc
ccgctggatgaatccgtgggcccggcccacgcacctgaagccccgttgcccaacgagctg
agcatcgacagccaggtctatggcggcgaactggtgctgcgctggacctacagtggcgaa
cgtttcgatgccgagttgatcggcgagctggcgagcgcctacctgggcgagctgcagagc
ctgatcgcccattgcctgaaggacgatgccggtggcctgacgccgtcggacttccccctg
gcgcgcttgacccaggcccagctcgatggcctgccggtgccggcggcgcagatcgaagac
gtctacccgctgaccccgatgcaggaaggcatgctgctgcacaccctgctggagccgggc
accggcctgtattacatgcaggaccgctaccgcatcaacagcgaactggacccggagcgt
ttcgcccaggcctggcaggcggtggtggcccgccatgaggctctgcgcgcgtccttctgc
tggaacgtcggcgaagacatgctgcaagttatccacaagccgggccgcaccccgatcgag
ttcctcgactggagcgcggtgcccgaggccgagcaagaggccaagctgcaggccctgcat
aaacaggagcgtgaggccggcttcgatctgctcaatcaggcgccgttccacctgcggctg
atccgcgtcggcgctgcgcgctactggttcatgatgagcaaccaccacatcctcatcgat
gcctggtgccgctcgttgctgatgaacgacttcttcgagatctacaccgccctgggcgaa
ggtcgcgaggcgcagctggcggtgccaccgcgttaccgcgactacatcggctggctgcag
caccagagcctgtcgcaggcgcggcagtggtggcggcagaaccttgaaggttttgaacgc
accacgccgatccccagcgaccggccgttcctgcgcgaacacgccggcgacagcggcggc
atgacagtcggcgactgctacacccgcctcgatgcccgggacggtgcgcaactgcgcgag
ctggcgcaacagcatcagctgaccatcaataccttcgctcaggcggcctgggccctggtg
ctgcggcgcatgagcggcgatcgcgacgtgctgttcggcgtcaccgtggccgggcgcccg
gtggacatgccgcagatgcaacgcaccgtcggcctgttcatcaacagcatcgccctgcgg
gtcaagctgcccgaggaggggcagcgctgcagcgtgcgccagtggctcagcggcttgctc
gacagcaacatgcagctgcgcgaatacgagtacctgccgctggtggcgatccaggaaacc
agcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgccccg
gtggaagtctcggtgctggaccgtgcccagagcctgaacgccagttcggattccggccgt
acccataccaacttcccgatcactgccgtgtgctacccgggggatgacctgggcctgcac
ctgtcctacgaccagcgctacttcgagcaggcgaccatcgagcgcatgctcggcgagttc
aagcgcctgctgctggccctgatgcagggtttccacggcgacatggccgaactgccgctg
ctgggtgaagaggagcaggacttcctgctcgccggctgcaaccagagcgagcatgagtac
ccgctggagcgcagctacgtggagctgttcgaggcccaggtggcggcccatccgcaacgc
gttgccgccagttgcctggatcagcgctatagctatgccgagttgaaccagtgcagcaac
cgtctgggccacgccctgatcgccaacggcgtgggttttgatcagccggtggccttgctg
gccgagcgcggcctggaactgctgggcatgatcatcggcagcttcaaggccggggccggc
tacctgcccctggacccgggcctgccaagtcagcgcctgggccgcatcatcgaactcagt
cgcacgccgatcctggtctgcagcgcggcttgccgcgaacaggcccaggccctgctggac
gagttcgcctgtgccgggcgtccgcggctgctggtctgggaggagctgcaagccgccggg
catgccgagagcaacccgggccgctacagcgcgccggacaacctggcctacgtgatctac
acctccggttccaccggcctgcccaagggcgtgatggtggagcagcgcggcatgctcaac
aaccagctgagcaaggtgccgtacctgcaactgagcgaggccgacgtgatcgcccagacg
gcgtcccagagcttcgacatatcggtctggcagttccttgccgcaccgctgttcggcgcc
cgggtcgacatcgtgcccaacaccatcgctcacgatccccagggcctcctggcccacgtc
gaggagcagggcatcacggtgctggagagcgtgccgtcgctgatccagggcatgctcgcc
caggacgtcatcgtcctcgatggcctgcgctggatgctgcccaccggcgaggccatgccg
cccgagctggcgcaccagtggctgctgcgttatccacagatcggcctggtgaacgcttac
ggcccggcggaatgctccgatgacgtggccttcttccgcgtcgacctggcctcgacccgg
ggcgcctacctgcccatcggtacgcccaccgacaacaaccgcctgtacctgatggacgaa
gccctggagctggtgcccctgggcgcggtcggcgagttgtgcgtggccggcaccggtatc
ggccgcggttacgtcagcgacccgttgcgtacagcgctggccttcgtgccccatccgttc
ggtgctgcgggcgaacgcctgtaccgcaccggcgacctggcacgccggcgcagcgacggc
gtattggaatacgttggccgtatcgaccaccaagtgaagatccgtggctatcgcatcgaa
ctgggggaaatcgaagcgcgcctgcacgaacagccggaactgcgcgatgccgccgtgggt
gtgcaggaaggggtcaacggcaagcatctggttgggtacctggtggccagtgacacgaac
ctgagcccgagcgaatgcctggagcggatcaagccgcggctgcgtgccgaactgccggaa
tacatggtgccactgcactggttgtggcttgcgcgcctgccgctcaacgccaacggcaag
ctcgatcgcaaggccctgccggccctggagatcggccagctgcagagccaggactatcaa
gcgccgggcaatgaactggagcaaaccctggcggacatctgggccgaggtgctcaaggtc
gagcgggtgggggtacgcgacaacttcttcgagttgggcgggcattccctgctggcgacc
cagatcgcttcacgggtacagaagaccctgcaacgcaacgtgccgctgcgggccatgttc
gaatgcagcacggtgcaggagttggccgcgtacatcgacggtttgggtgccaatgaaatc
agcgaggagaaggtcgaccgcctgagtgacctgatggccgagctggaggggctgtga

DBGET integrated database retrieval system