KEGG   Pseudomonas protegens Cab57: PPC_4346Help
Entry
PPC_4346          CDS       T03613                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00220  Arginine biosynthesis
ppro00250  Alanine, aspartate and glutamate metabolism
ppro00290  Valine, leucine and isoleucine biosynthesis
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01130  Biosynthesis of antibiotics
ppro01210  2-Oxocarboxylic acid metabolism
ppro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPC_4346
   00290 Valine, leucine and isoleucine biosynthesis
    PPC_4346
   00220 Arginine biosynthesis
    PPC_4346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppro01007]
    PPC_4346
Enzymes [BR:ppro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PPC_4346
    2.6.1.66  valine---pyruvate transaminase
     PPC_4346
Amino acid related enzymes [BR:ppro01007]
 Aminotransferase (transaminase)
  Class I
   PPC_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: BAO63693
LinkDB All DBs
Position
4869882..4871093
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGIGIEDIYLGNGVSELIVMAMQALLNNGDE
VLVPAPDYPLWTAAVSLAGGNPVHYLCDEQANWWPDLADIKAKITPNTKALVIINPNNPT
GAVYPREVLLGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWVAISGPKQHAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKICPIHNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGSFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgttatgacattcgcggcccagtg
ctcaagcacgccaaacgtctggaagaggaaggccaccgcatcctcaagctgaatatcggc
aacccggcgccctttggtttcgaagcgccggacgaaatcctccaggacgtgatccgcaac
ctgcccactgcccagggctacagcgactccaagggcctgttcagtgcccgcaaggcggtg
atgcagtactaccagcagaagcaggtggaaggcatcggcatcgaagacatctacctgggc
aacggtgtttccgaactgatcgtgatggccatgcaggccctgctcaacaacggcgacgaa
gtgctggtgccggcccccgactacccgctgtggaccgccgcggtgagcctggccggcggc
aacccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggccgacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaaccccacc
ggcgccgtctaccccagggaagtgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctcggacgagatctacgacaagatcctctacgacgacgccgtacacatc
tgcaccgcctcgctggcaccggacctgctgtgcctgaccttcaacggcctgtccaagtcc
tatcgggtagccggtttccgttccggctgggtggccatttccggtcccaagcagcacgcc
cagagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccc
agccagcacgccatccagaccgcactgggcggctaccagagcatcaacgacctggtgctg
cccccgggccgcctgctggaacagcgcaaccgtacctgggaactgctcaacgacattccc
ggagtcagttgcgtcaagcccatgggcgcgctgtatgccttcccgcggatcgacccgaag
atctgcccgatccacaacgacgagaagttcgtcctcgacctgctgctctcggaaaagctc
ctggtggtgcaaggcacggccttcaactggccatggccggatcacttccgcgtcgtgacc
ctgccgcgggtggatgacctggagcaggccattggtcggatcggcagcttcctcaagtcc
taccgccagtaa

DBGET integrated database retrieval system