KEGG   Pseudomonas protegens Cab57: PPC_4835Help
Entry
PPC_4835          CDS       T03613                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppro  Pseudomonas protegens Cab57
Brite
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PPC_4835 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAO64182
LinkDB All DBs
Position
5386258..5386854
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKNFVA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctatgcacacgacgctctgcagccgcacatttcc
aaggaaaccctggaataccaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaagactctggaagagatcgtcaaaacctct
tcgggcggcatcttcaacaacgcagcccaggtctggaaccacactttctactggaactgc
ctggcgccaaacgccggcggccaacctaccggcgccctggctgaagccatcaatgctgcg
ttcggttcgttcgacaagttcaaagaagaattcaccaagacttcggttggcaccttcggt
tccggctggggctggctggtgaaaaaggctgacggctccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacgttcgtccaaaatacgtcgaagcgttctggaac
ctggtcaactggaaattcgtggctgagcagttcgaaggcaagaacttcgtcgcttaa

DBGET integrated database retrieval system