KEGG   Pseudomonas protegens Cab57: PPC_5057Help
Entry
PPC_5057          CDS       T03613                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00473  D-Alanine metabolism
ppro00550  Peptidoglycan biosynthesis
ppro01100  Metabolic pathways
ppro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PPC_5057 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PPC_5057 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PPC_5057 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppro01011]
    PPC_5057 (ddl)
Enzymes [BR:ppro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PPC_5057 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ppro01011]
 Precursor biosynthesis
  Amino acid ligase
   PPC_5057 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_YheCD GARS_A ATPgrasp_Ter TTL
Motif
Other DBs
NCBI-ProteinID: BAO64404
LinkDB All DBs
Position
complement(5620028..5620984)
Genome map
AA seq 318 aa AA seqDB search
MIAAYANLFSTVKPSDFGRVAVLYGGKSAEREVSLKSGKAVLEALQSGGVNAFGIDVGDD
LLQRLLSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGISTPRHAVLSSEADCISAVAELGLPLIVKPAHEGSSIGMAKVTSAPELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDSS
KEQELMELTAKACEALGIAGWARADVMQDAQGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASLEARG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctgcctacgccaacctgttctctaccgtgaaaccgagcgatttcggtcgcgtc
gccgttctttacggtggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaaggcc
gtgcttgaagcgctgcagagcggcggtgtgaacgccttcggcatcgacgtcggcgatgat
ctgctgcagcggctcttgagcgagaagatcgatcgtgccttcatcattctccacggtcgt
ggcggtgaagacggcagcatgcaagggctgctggagtgcctggggattccttacaccggc
agcggcatcctcgcttcggccctggccatggacaaactgcgtaccaagcaggtctggcac
agcctgggcatttcgacgccgcgtcacgcggttctgagttcggaagccgactgtatttcc
gcggtggcggaactgggcctgcctttgatcgtcaaaccggctcatgaaggctccagtatc
ggtatggccaaggtgacttccgcgcccgaattgatcgacgcatggaaggcggccagtacc
tacgattcgcaagtgttggtcgagcaatggatccagggtccggagttcaccatcgcgacc
ctgcgtgaccaggtgctgccacccatcgccctgggcactccccacacattttacgactac
gacgccaagtatctggcttccgatacccagtaccggatcccgtgcgggctcgacagctcc
aaggaacaggaactcatggaactcacggcgaaagcctgtgaggcgctcggtatcgccggt
tgggcacgtgccgacgtgatgcaggacgcccaggggcagttctggttcctggaagtgaat
accgctccgggcatgaccgatcacagtttggttccgatggcggcccgcgcggccggcctg
gatttccagcaactggtattggccatcctggcagccagtcttgaggcgagaggttaa

DBGET integrated database retrieval system