KEGG   Pseudomonas protegens Cab57: PPC_6075Help
Entry
PPC_6075          CDS       T03613                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00010  Glycolysis / Gluconeogenesis
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01120  Microbial metabolism in diverse environments
ppro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPC_6075
Enzymes [BR:ppro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PPC_6075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MBD
Motif
Other DBs
NCBI-ProteinID: BAO65422
LinkDB All DBs
Position
6706517..6707410
Genome map
AA seq 297 aa AA seqDB search
MPQVETVKLDELNCWRIRHGDAELLVAQQGAHILSYQVAGQQPLIWLNDEAVFKRGKSIR
AGVPVCWPWFGNFARNPQAVQAMRQGTDPAPAHGLVRATDWELLGIESQGDSLLVELHLP
CPAGGFPGWPHQVEPRLSIRLDQQLHISLSSHNLGTESVSISQALHSYFAVSDVRQVQVE
GVDGLSYIETLEDWKTKVQSGSLHFTGETDRIYLNAPTQLEIVDPDWQRRIRLRSEGSRT
AVIWNPWIDRAAQFSDMADDGWQRMLCIETANVMDDIITLAPGASHTLSVSISAAPL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggtcgaaacggtaaaactggatgaactgaactgctggcgcatccgccacggt
gacgccgaactgctggtggcccagcagggcgcgcacatcctcagttatcaagtggccggg
caacagccgctgatctggctgaacgacgaggccgtgttcaagcgcggcaagagcatccgc
gccggggtgccggtgtgctggccctggttcggcaactttgcccgcaacccgcaggcggtg
caggccatgcgccaaggcactgacccggcgccggcccacggcctggtgcgggccaccgac
tgggaactgctgggcatcgaaagccagggcgacagcctgctggttgagctgcacctgccc
tgccccgcgggtggttttcccggctggccccatcaagtggaaccacgcctgagcatccgc
ctcgaccagcaactgcacatcagcctcagcagccacaacctgggcactgaaagcgtgagc
atcagccaggcgctgcacagctacttcgcggtcagcgatgtgcgccaggtgcaggtcgaa
ggcgtggacgggctgagctacatcgagaccctggaagactggaagaccaaggtccagagc
ggcagcctgcactttaccggcgagaccgaccgcatctacctgaacgccccgacgcagctg
gagatcgtcgacccggactggcaacggcggatccgcctgcgcagcgaaggctcgcgcacc
gcggtgatctggaacccctggatcgaccgcgccgcccaattcagcgacatggccgacgac
ggctggcagcgcatgctgtgcatcgagaccgccaacgtgatggacgacatcatcaccctg
gccccgggcgccagccacaccctgagcgtcagcatcagcgccgccccgctctga

DBGET integrated database retrieval system