KEGG   Pan paniscus (bonobo): 100967296Help
Entry
100967296         CDS       T02283                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin 5
  KO
K17345  tetraspanin-5
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100967296 (TSPAN5)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100967296 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 100967296
NCBI-ProteinID: XP_003829966
UniProt: A0A2R9CKV7
LinkDB All DBs
Position
4
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcactacaagggtcctgaagtcagttgttgcatcaaatacttcatattt
ggcttcaatgtcatattttggtttttgggaataacatttcttggaattggactgtgggca
tggaatgaaaaaggagttctgtccaacatctcttccatcaccgatctcggcggctttgac
ccagtttggctcttccttgtggtgggaggagtgatgttcattttgggatttgcagggtgc
attggagcgctacgggaaaacactttccttctcaagtttttttctgtgttcctgggaatt
attttcttcctggagctcactgccggagttctagcatttgttttcaaagactggatcaaa
gaccagctgtatttctttataaacaacaacatcagagcatatcgggatgacattgatttg
caaaacctcatagacttcacccaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaatgcaagtcgagagcgatgt
ggcgttccattctcctgctgcactaaagatcccgcagaagatgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagaagttgaccagcagattgtaatctacacgaaaggc
tgtgtgccccagtttgagaagtggttgcaggacaatttaaccatcgttgctggtattttc
ataggcattgcattgctgcagatttttgggatatgcctggcccagaatttggttagcgat
atcgaagctgtcagggcgagctggtag

DBGET integrated database retrieval system