KEGG   Pan paniscus (bonobo): 100967827
Entry
100967827         CDS       T02283                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01523  Antifolate resistance
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04218  Cellular senescence
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04657  IL-17 signaling pathway
pps04659  Th17 cell differentiation
pps04668  TNF signaling pathway
pps04672  Intestinal immune network for IgA production
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05332  Graft-versus-host disease
pps05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100967827 (IL6)
   04668 TNF signaling pathway
    100967827 (IL6)
   04066 HIF-1 signaling pathway
    100967827 (IL6)
   04068 FoxO signaling pathway
    100967827 (IL6)
   04151 PI3K-Akt signaling pathway
    100967827 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100967827 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100967827 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100967827 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100967827 (IL6)
   04620 Toll-like receptor signaling pathway
    100967827 (IL6)
   04621 NOD-like receptor signaling pathway
    100967827 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100967827 (IL6)
   04625 C-type lectin receptor signaling pathway
    100967827 (IL6)
   04659 Th17 cell differentiation
    100967827 (IL6)
   04657 IL-17 signaling pathway
    100967827 (IL6)
   04672 Intestinal immune network for IgA production
    100967827 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100967827 (IL6)
   05202 Transcriptional misregulation in cancer
    100967827 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100967827 (IL6)
   05321 Inflammatory bowel disease
    100967827 (IL6)
   05332 Graft-versus-host disease
    100967827 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100967827 (IL6)
   05020 Prion disease
    100967827 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100967827 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100967827 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100967827 (IL6)
   04931 Insulin resistance
    100967827 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100967827 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100967827 (IL6)
   05135 Yersinia infection
    100967827 (IL6)
   05133 Pertussis
    100967827 (IL6)
   05134 Legionellosis
    100967827 (IL6)
   05152 Tuberculosis
    100967827 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100967827 (IL6)
   05161 Hepatitis B
    100967827 (IL6)
   05171 Coronavirus disease - COVID-19
    100967827 (IL6)
   05164 Influenza A
    100967827 (IL6)
   05162 Measles
    100967827 (IL6)
   05168 Herpes simplex virus 1 infection
    100967827 (IL6)
   05163 Human cytomegalovirus infection
    100967827 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100967827 (IL6)
   05169 Epstein-Barr virus infection
    100967827 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100967827 (IL6)
   05144 Malaria
    100967827 (IL6)
   05142 Chagas disease
    100967827 (IL6)
   05143 African trypanosomiasis
    100967827 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100967827 (IL6)
   01523 Antifolate resistance
    100967827 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100967827 (IL6)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100967827 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 100967827
NCBI-ProteinID: XP_008958307
LinkDB
Position
7
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcatcctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

DBGET integrated database retrieval system