KEGG   Pan paniscus (bonobo): 100968611
Entry
100968611         CDS       T02283                                 

Gene name
RAB9B
Definition
(RefSeq) RAB9B, member RAS oncogene family
  KO
K07900  Ras-related protein Rab-9B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05132  Salmonella infection
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100968611 (RAB9B)
  09172 Infectious disease: viral
   05162 Measles
    100968611 (RAB9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100968611 (RAB9B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100968611 (RAB9B)
Membrane trafficking [BR:pps04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100968611 (RAB9B)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    100968611 (RAB9B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_7 AAA_16
Other DBs
NCBI-GeneID: 100968611
NCBI-ProteinID: XP_003819697
UniProt: A0A2R8ZB34
LinkDB
Position
X
AA seq 201 aa
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFV
VLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE
HCMLGHTIDLNSGSKAGSSCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagtgggaaatccctgctcttaaaggtcattctcttgggtgatggtggagttgggaaa
agttcgcttatgaaccgttatgtaaccaacaaatttgactcccaggcttttcacaccata
ggggtagagttcttaaatcgagatctggaggtagatggacgctttgtaaccctccagatc
tgggacactgcagggcaggaacgtttcaagagccttaggacacccttctacaggggagca
gactgctgcctcttgaccttcagcgtggatgatcggcagagcttcgagaatcttggtaac
tggcagaaagaatttatttactatgcggatgtgaaggaccctgagcatttcccctttgta
gttctgggtaacaaggtagacaaagaggataggcaagtgactactgaggaggcacaaacc
tggtgcatggagaatggggattacccttatttagaaactagtgccaaagatgatactaat
gtgacagtggcctttgaagaagctgtcaggcaggtgctggctgtagaggaacagctggag
cattgcatgttgggtcacaccattgacttgaacagtggctccaaagcagggtcttcgtgc
tgttaa

KEGG   Pan paniscus (bonobo): 100990180
Entry
100990180         CDS       T02283                                 

Gene name
RAB9A
Definition
(RefSeq) RAB9A, member RAS oncogene family
  KO
K07899  Ras-related protein Rab-9A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05132  Salmonella infection
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100990180 (RAB9A)
  09172 Infectious disease: viral
   05162 Measles
    100990180 (RAB9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100990180 (RAB9A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100990180 (RAB9A)
Membrane trafficking [BR:pps04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100990180 (RAB9A)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    100990180 (RAB9A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU ATP_bind_1 G-alpha PduV-EutP AAA_7 AAA_16 SRPRB FeoB_N
Other DBs
NCBI-GeneID: 100990180
NCBI-ProteinID: XP_003805740
UniProt: A0A2R8ZQK1
LinkDB
Position
X
AA seq 201 aa
MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD
HLIQTDTVNLHRKPKPSSSCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcaggaaaatcatcactttttaaagtaattctccttggagatggtggagttgggaag
agttcacttatgaacagatatgtaactaataagtttgatacccagctcttccatacaata
ggtgtggaatttttaaataaagatttggaagtggatggacattttgttaccatgcagatt
tgggacacggcaggtcaggagcgattccgaagcctgaggacaccattttacagaggttct
gactgctgcctgcttacttttagtgtcgatgattcacaaagcttccagaacttaagtaac
tggaagaaagaattcatatattatgcagatgtgaaagagcctgagagctttccttttgtg
attctgggtaacaagattgacataagcgaacggcaggtgtctacagaagaagcccaagct
tggtgcagggacaacggcgactatccttattttgaaacaagtgcaaaagatgccacaaat
gtggcagcagcctttgaggaagcggttcgaagagttcttgctaccgaggataggtcagat
catttgattcagacagacacagtcaatcttcaccgaaagcccaagcctagctcatcttgc
tgttga

DBGET integrated database retrieval system