KEGG   Pan paniscus (bonobo): 100969261Help
Entry
100969261         CDS       T02283                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00052  Galactose metabolism
pps00500  Starch and sucrose metabolism
pps01100  Metabolic pathways
pps04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100969261
   00500 Starch and sucrose metabolism
    100969261
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100969261
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100969261
    3.2.1.20  alpha-glucosidase
     100969261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 100969261
NCBI-ProteinID: XP_014201316
LinkDB All DBs
Position
7
AA seq 483 aa AA seqDB search
LYRAYVAFPDFFRNSTGKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSP
GCRDASLNHPPYMPYLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTY
EAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGA
DICGFFEDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYT
LLPYLYTLMHKAHTEGITVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVT
AYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFM
GFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPL
KLGYIEIWGVGSVPITSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWI
ITL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ctatatcgagcttatgtggccttcccagactttttccgtaattcaactggcaagtggtgg
aagagggaaatagaagaactatacaacaatccacagaatccagagaggagcttgaagttt
gatggcatgtggattgatatgaatgaaccatcaagcttcgtgaatggggcagtttctcca
ggctgcagggacgcctctctgaaccaccctccctacatgccgtatttggagtccagggac
aggggcctgagcagcaagaccctgtgcatggagagtcagcagatcctcccagacggctcc
ctggtgcagcactacaacgtgcacaacctgtatgggtggtcccagaccagacctacatac
gaagccgtgcaggaggtgacgggacagcgaggggtcgtcatcacccgctccacatttccc
tcttctggccgctgggcaggacattggctgggagacaacacggccgcgtgggatcagctg
aagaaatctatcattggcatgatggagttcagcctcttcggcatatcctatacgggagca
gatatctgtgggttctttgaagatgctgaatatgagatgtgtgttcgctggatgcagctg
ggggccttttaccccttctcaagaaaccacaacaccattgggaccaggagacaagaccct
gtgtcctgggatgttgcttttgtgaatatttccagaactgtcctgcagaccagatacacc
ttgttgccatatctgtataccttgatgcataaggcccacacggagggcatcactgttgtg
cggcctctgctccatgagtttgtgtcagaccaggtgacatgggacatagacagtcagttc
ctgctgggcccagccttcctggtcagccctgtcctggagcgcaatgccagaaatgtcact
gcatatttccctagagcccgttggtacgattactacacgggtgtggatattaatgcaaga
ggagagtggaagaccttgccagcccctcttgaccacattaatcttcatgtccgtgggggc
tacatcctgccctggcaagagcctgcactgaacacccacttaagccgccagaaattcatg
ggcttcaaaattgccttggatgatgaaggaactgctgggggctggctcttctgggatgat
gggcaaagcattgatacctatgggaaaggactctattacttggccagcttttctgccagc
cagaatacgatgcaaagccatataattttcaacaattacatcactggtacaaatcctttg
aaactgggctacattgaaatctggggagtgggcagtgtccccattaccagtgtcagcatc
tctgtgagtggcatggtcataacaccctccttcaacaatgaccccacgacacaggtatta
agcatcgatgtgactgacagaaacatcagcctacataattttacttcattgacgtggata
atcactctgtga

DBGET integrated database retrieval system