KEGG   Pan paniscus (bonobo): 100969508
Entry
100969508         CDS       T02283                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100969508 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100969508 (PTGDR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100969508 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 ResB PhoR
Other DBs
NCBI-GeneID: 100969508
NCBI-ProteinID: XP_003831761
UniProt: A0A2R9BPP7
LinkDB
Position
14
AA seq 359 aa
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPSLDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSVFSLAFCALPFMGFGKFVQYCPG
TWCFIQLVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDRAELRADGKEASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaagtcgcccttctaccgctgccagaacaccacctctgtggaaaaaggcaactcggcg
gtgatgggcggggtgctcttcagcaccggcctcctgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctcgcggcgtccactgcgcccgctgccctcggtc
ttctacatgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
ccggtggtgctggctgcctacgctcagaaccggagtctgcgggtgcttgcgccctcattg
gacaactcgttgtgccaagccttcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccctttcttctac
cgacggcacatcaccctgcgcctgggcgcactggtggccccggtggtgagcgtcttctcc
ctggctttctgcgcgctacctttcatgggcttcgggaagttcgtgcagtactgccccggc
acctggtgctttatccagctggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtcctcgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctatgcgatgcacaggcggctgcagcggcacccgcgctcctgcacc
agggaccgtgccgagctgcgcgcggacgggaaagaagcgtcccctcagcccctggaggag
ctggatcacctcctgctgctggcgctgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatgtcaaggagaaaaacaggacctct
gaagaagcagaagacctccgagccttgcgatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagatctccagtatttcggatattttttcacaagattttcatt
agacctcttaggtacaggagccggtgcagcaattccactaacatggaatccagtctgtga

DBGET integrated database retrieval system