KEGG   Pan paniscus (bonobo): 100969963Help
Entry
100969963         CDS       T02283                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03030  DNA replication
pps03410  Base excision repair
pps03420  Nucleotide excision repair
pps03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100969963 (LIG1)
   03410 Base excision repair
    100969963 (LIG1)
   03420 Nucleotide excision repair
    100969963 (LIG1)
   03430 Mismatch repair
    100969963 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pps03032]
    100969963 (LIG1)
   03400 DNA repair and recombination proteins [BR:pps03400]
    100969963 (LIG1)
Enzymes [BR:pps01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100969963 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100969963 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100969963 (LIG1)
DNA replication proteins [BR:pps03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100969963 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100969963 (LIG1)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100969963 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100969963 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100969963 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685 DDR
Motif
Other DBs
NCBI-GeneID: 100969963
NCBI-ProteinID: XP_003814148
UniProt: A0A2R9CMP9
LinkDB All DBs
Position
19
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEAETPKESLTEAEVATEKEGEDRDQ
ATTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPRTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaatagcagcagagagacggagccccctccaaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccggtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccctggactgctcacaggtctccccgccccgtcctgccacatctcctgaa
aacaatgcttccctctctgacacctctcccatggacagttccccatcagggattccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgaggacgaggacagagaagccaagaggaagaaggaggaggaagaagcggagaccccg
aaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
gccaccacgcctcccaagcccctaaagacctccaaagcagagaccccgacggaaagcgtt
tcagagcctgaggtggccacgaagcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagagctcccaggacgctcagcagcttcttcaccccccggaagccagcaatcaaa
aaagaagtgaaggaagaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggatccatccggttacaatcctgccaagaacaactatcatcccgtggaagatgcctgc
tggaaaccgggccagaaggttccttacctggccgtggcccggacgtttgagaagatcgag
gaggtgtctgctcggctccggatggtggagacgctgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctctacctcagcctcaaccaccttgggcca
ccccagcagggcctggagcttggcgtgggtgatggtgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtccgtccgggctgaggcagccgagaaaggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccactcact
gcctccggggtcttcagcaagttccgcgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgccttgggctggcagagcagtcggtgctg
gctgccctctcccaggcagtgagcctcacgcccccgggccaagaattcccaccagccgtg
gtggatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacgttctgcgaggttcccgacctggaccgaattatccccgtgctg
ctggagcatggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacccggggcgtcagcgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatatgacgggcagagggcacagatccatgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactgggaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacacc
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaggtggatgcatccgagatccaggtgcaggtgtgtttgtacgctttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacagagggcgagtttgtcttcgccacctccctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgttgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggctggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggagcatcaccagagcctcaaggccctggtgctgcccagccca
cgcccttacgtgcggatagatggcgctgtgattcccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgcgctgacctctccctctcccccatctaccctgctgcgcggggc
ctggtggatagtgacaagggcatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaaacagccggagcaggccaccaccagtgcccaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system