KEGG   Pan paniscus (bonobo): 100969975Help
Entry
100969975         CDS       T02283                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00051  Fructose and mannose metabolism
pps00052  Galactose metabolism
pps00500  Starch and sucrose metabolism
pps00520  Amino sugar and nucleotide sugar metabolism
pps00524  Neomycin, kanamycin and gentamicin biosynthesis
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps04066  HIF-1 signaling pathway
pps04910  Insulin signaling pathway
pps04930  Type II diabetes mellitus
pps04973  Carbohydrate digestion and absorption
pps05230  Central carbon metabolism in cancer
Module
pps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100969975 (HK1)
   00051 Fructose and mannose metabolism
    100969975 (HK1)
   00052 Galactose metabolism
    100969975 (HK1)
   00500 Starch and sucrose metabolism
    100969975 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100969975 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100969975 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100969975 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100969975 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100969975 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100969975 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100969975 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100969975 (HK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100969975 (HK1)
Membrane trafficking [BR:pps04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100969975 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100969975
NCBI-ProteinID: XP_008967167
LinkDB All DBs
Position
10
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctcatagatatcatg
actcgcttcaggaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtccgaggtttatgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aggaagatcaaggacaagaagttacctgtgggattcacgttttcttttccttgccaacaa
tccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaagcgagcggagtg
gaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcgaggggactatgat
gccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctatgac
gaccagcactgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaatacagaa
tggggagcctttggagacgatggatcattagaagacatccggacagagtttgacagggag
atagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcacccgagggaagtttaacaccagtgatgtgtca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgatgactgtgtctcagtccagcacgtttgcaccattgtctcattt
cgctcagccaacttggtggctgccacactgggcgccatcttgaaccgcctgcgtgataac
aagggcacacccaggctgcggaccacggttggtgtcgacggatctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctaaggcgcttggtgccagactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggctgccatggtaacggcggtggcc
taccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctgagg
aagcagacgcacaacaatgccgcggttaagatgctgccctccttcgtccggagaactcct
gacgggaccgagaatggtgacttcttggccctggatcttggaggaaccaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctac
gccattcctattgaaatcatgcagggcactggggaagagctgtttgatcacattgtctcc
tgcatctctgacttcttggactacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccctgccagcagacgagtctggacgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgcgtgggccacgatgtagtcaccttactaagggatgcg
ataaaaaggagagaggaatttgacctggacgtggtagctgtggtcaacgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggttggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagacggtggagggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacacactacgacagactggtggacgaatattccctaaatgctgggaaacaaagg
tatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatcgac
ttcaccaagaagggattcctcttccgagggcagatctctgagacgctgaagacccggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtc
cgggctatcctccagcagctgggtctgaatagcacctgcgatgacagtatcctcgtcaag
acggtgtgtggggtggtgtccaggagggccgcacagctgtgtggcgcaggcatggctgcg
gttgtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtgggagtg
gacgggacactctacaagcttcatccacacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggcagcggcaagggg
gccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagcagctaa

DBGET integrated database retrieval system