KEGG   Pan paniscus (bonobo): 100970542
Entry
100970542         CDS       T02283                                 

Gene name
ACTG1
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04145  Phagosome
pps04210  Apoptosis
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04611  Platelet activation
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04810  Regulation of actin cytoskeleton
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
pps05014  Amyotrophic lateral sclerosis
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05164  Influenza A
pps05205  Proteoglycans in cancer
pps05225  Hepatocellular carcinoma
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100970542 (ACTG1)
   04390 Hippo signaling pathway
    100970542 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100970542 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    100970542 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100970542 (ACTG1)
   04520 Adherens junction
    100970542 (ACTG1)
   04530 Tight junction
    100970542 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100970542 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100970542 (ACTG1)
   04670 Leukocyte transendothelial migration
    100970542 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100970542 (ACTG1)
   04919 Thyroid hormone signaling pathway
    100970542 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    100970542 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100970542 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100970542 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100970542 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100970542 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100970542 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    100970542 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100970542 (ACTG1)
   05414 Dilated cardiomyopathy
    100970542 (ACTG1)
   05416 Viral myocarditis
    100970542 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100970542 (ACTG1)
   05135 Yersinia infection
    100970542 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    100970542 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    100970542 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    100970542 (ACTG1)
   03019 Messenger RNA biogenesis [BR:pps03019]
    100970542 (ACTG1)
   03036 Chromosome and associated proteins [BR:pps03036]
    100970542 (ACTG1)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100970542 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100970542 (ACTG1)
   04147 Exosome [BR:pps04147]
    100970542 (ACTG1)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100970542 (ACTG1)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100970542 (ACTG1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100970542 (ACTG1)
    NuA4 complex
     100970542 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    100970542 (ACTG1)
   PBAF complex
    100970542 (ACTG1)
   SWR1 complex
    100970542 (ACTG1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100970542 (ACTG1)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100970542 (ACTG1)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100970542 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100970542
NCBI-ProteinID: XP_003831173
UniProt: A0A2R9BH44
LinkDB
Position
17
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggt
tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgacccagacac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggccccggaggag
cacccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccctctacgcctctgggcgcaccactggcattgtcatggactctggagacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgaggctacagcttc
accaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgccgcatcctcttcttctctggagaagagctac
gagctgcccgatggccaggtcatcaccatcggcaatgagcggttccggtgtccggaggcg
ctgttccagccttccttcctgggcatggaatcttgcggcatccacgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtatgccaacacggtgctgtcg
ggcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcaccgccctg
gcgcccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcggtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Pan paniscus (bonobo): 100990579
Entry
100990579         CDS       T02283                                 

Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04145  Phagosome
pps04210  Apoptosis
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04611  Platelet activation
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04810  Regulation of actin cytoskeleton
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04971  Gastric acid secretion
pps05014  Amyotrophic lateral sclerosis
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05164  Influenza A
pps05205  Proteoglycans in cancer
pps05225  Hepatocellular carcinoma
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100990579
   04390 Hippo signaling pathway
    100990579
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100990579
  09143 Cell growth and death
   04210 Apoptosis
    100990579
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100990579
   04520 Adherens junction
    100990579
   04530 Tight junction
    100990579
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100990579
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100990579
   04670 Leukocyte transendothelial migration
    100990579
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100990579
   04919 Thyroid hormone signaling pathway
    100990579
  09154 Digestive system
   04971 Gastric acid secretion
    100990579
  09159 Environmental adaptation
   04714 Thermogenesis
    100990579
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100990579
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100990579
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100990579
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100990579
   05410 Hypertrophic cardiomyopathy
    100990579
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100990579
   05414 Dilated cardiomyopathy
    100990579
   05416 Viral myocarditis
    100990579
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100990579
   05135 Yersinia infection
    100990579
   05100 Bacterial invasion of epithelial cells
    100990579
  09172 Infectious disease: viral
   05164 Influenza A
    100990579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    100990579
   03019 Messenger RNA biogenesis [BR:pps03019]
    100990579
   03036 Chromosome and associated proteins [BR:pps03036]
    100990579
   03029 Mitochondrial biogenesis [BR:pps03029]
    100990579
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100990579
   04147 Exosome [BR:pps04147]
    100990579
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100990579
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100990579
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100990579
    NuA4 complex
     100990579
  Chromatin remodeling factors
   BAF complex
    100990579
   PBAF complex
    100990579
   SWR1 complex
    100990579
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100990579
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100990579
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100990579
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100990579
NCBI-ProteinID: XP_008961539
LinkDB
Position
5
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcctatgtgggcgacgaggcccagagc
aagagaggcatcctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcccgaggag
caccccgtgctgctcaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgttgctatccaggctgtgcta
tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacggctgcttccagctcctccctggagaagagctac
gagctgcctgacggccaggtcatcaccattggcaatgagcggttccgctgccctgaggca
ctcttccagccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacacagtgctgtct
ggcggcaccaccatgtaccctggcattgccgacaggatgcagaaggagatcactgccctg
gcacccagcacaatgaagatcaagatcattgctcctcctgagcgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system