KEGG   Pan paniscus (bonobo): 100970731Help
Entry
100970731         CDS       T02283                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00053  Ascorbate and aldarate metabolism
pps00071  Fatty acid degradation
pps00260  Glycine, serine and threonine metabolism
pps00280  Valine, leucine and isoleucine degradation
pps00310  Lysine degradation
pps00330  Arginine and proline metabolism
pps00340  Histidine metabolism
pps00380  Tryptophan metabolism
pps00410  beta-Alanine metabolism
pps00561  Glycerolipid metabolism
pps00620  Pyruvate metabolism
pps01100  Metabolic pathways
Module
pps_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pps_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100970731 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    100970731 (ALDH7A1)
   00620 Pyruvate metabolism
    100970731 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100970731 (ALDH7A1)
   00561 Glycerolipid metabolism
    100970731 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100970731 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    100970731 (ALDH7A1)
   00310 Lysine degradation
    100970731 (ALDH7A1)
   00330 Arginine and proline metabolism
    100970731 (ALDH7A1)
   00340 Histidine metabolism
    100970731 (ALDH7A1)
   00380 Tryptophan metabolism
    100970731 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100970731 (ALDH7A1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100970731 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100970731 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100970731 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100970731
NCBI-ProteinID: XP_003826729
LinkDB All DBs
Position
5
AA seq 566 aa AA seqDB search
MGSPGRGAGLYFSSSQGFVLIPSPGLSMWRLPRALCVHAAKTSKLPGPWSRPAAFMSTLL
INQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVK
KAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDI
CDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGN
VCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFT
GSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTV
RRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGG
TVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQ
GLASSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcccgggcggggggcggggctctatttcagcagctctcagggctttgtgctc
atcccgagtcccgggctcagtatgtggcgcctgccacgcgcgctgtgtgtgcatgctgca
aagaccagcaagctccctggaccttggagcaggcctgccgccttcatgtccactctcctc
atcaatcagccccagtatgcgtggctgaaagagctggggctccgcgaggaaaacgagggc
gtgtataatggcagctggggaggccggggagaggttattacgacctattgccctgctaac
aacgagccaatagcaagagtccgacaggccagtgtggcagactatgaagaaactgtaaag
aaagcaagagaagcatggaaaatctgggcagatattcctgctccaaaacgaggagaaata
gtaagacagattggcgatgccttgcgggagaagatccaagtactaggaagcttggtgtct
ttggagatggggaaaatcttagtggaaggtgtgggtgaagttcaggagtatgtggatatc
tgtgactatgctgttggtttatcaaggatgattggaggacctatcttgccttctgaaaga
tctggccatgcactgattgagcagtggaatcccgtaggcctggttggaatcatcacggca
ttcaatttccctgtggcagtgtatggttggaacaacgccatcgccatgatctgtggaaat
gtctgcctctggaaaggagctccaaccacttccctcattagtgtggctgtcacaaagata
atagccaaggttctggaggacaacaagctgcctggtgcaatttgttccttgacttgtggt
ggagcagatattggcacagcaatggccaaagatgaacgagtgaacctgctgtccttcact
gggagcactcaggtgggaaaacaggtgggcctgatggtgcaggagaggtttgggagaagt
ctgttggaacttggaggaaacaatgccattattgcctttgaagatgcagacctcagctta
gttgttccatcagctctcttcgctgccgtgggaacagctggccagaggtgtaccactgtg
aggcgactgtttatacatgaaagcatccatgatgaggttgtaaacagacttaaaaaggcc
tatgcacagatccgagttgggaacccatgggaccctaatgttctctatgggccactccac
accaagcaggcagtgagcatgtttcttggagcagtggaagaagcaaagaaagaaggtggc
acagtggtctatgggggcaaggttatggatcgccctggaaattacgtagaaccgacaatt
gtgacaggtcttggccacgatgcgtccattgcacacacagagactttcgctccgattctc
tatgtctttaaattcaagaatgaagaagaggtctttgcatggaataatgaagtaaaacag
ggacttgcaagtagcatctttaccaaagatctgggcagaatctttcgctggcttggacct
aaaggatcagactgtggcattgtaaatgtcaacattccaacaagtggggctgagattgga
ggtgcctttggaggagaaaagcacactggtggtggcagggagtctggcagtgatgcctgg
aaacagtacatgagaaggtctacttgtactatcaactacagtaaagaccttcctctggcc
caaggaatcaagtttcagtaa

DBGET integrated database retrieval system