KEGG   Pan paniscus (bonobo): 100970839Help
Entry
100970839         CDS       T02283                                 

Gene name
METAP1D
Definition
(RefSeq) methionyl aminopeptidase type 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100970839 (METAP1D)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     100970839 (METAP1D)
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M24
   100970839 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 100970839
NCBI-ProteinID: XP_003824315
UniProt: A0A2R9BJG7
LinkDB All DBs
Position
2B
AA seq 335 aa AA seqDB search
MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMT
TEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQ
NGFQVCPHFVGHGIGSYFHGHPEIWHHANDNDLPMEEGMAFTIEPIITEGSPEFKVLEDA
WTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccagtggcgtccacctgctcgtccgcagaggttctcatagaattttctct
tcaccactcaatcatatctacttacacaagcagtcaagcagtcaacaaagaagaaatttc
ttttttcggagacaaagagatatttcacacagtatagttttgccggctgcagtttcttca
gctcatccggttcctaagcacataaagaagccagactatgtgacgacaggcattgtacca
gactggggagacagcatagaagttaagaatgaagatcagattcaagggcttcatcaggct
tgtcagctggcccgccacgtcctcctcttggctgggaagagtttaaaggttgacatgaca
actgaagagatagatgctcttgttcatcgggaaatcatcagtcataatgcctatccctca
cctctaggctatggaggttttccaaaatctgtttgtacctctgtaaacaacgtgctctgt
catggtattcctgacagtcgacctcttcaggatggagatattatcaacattgatgtcaca
gtctattacaatggctaccatggagacacctctgaaacatttttggtgggcaatgtggac
gaatgtggtaaaaagttagtggaggttgccaggaggtgtagagatgaagcaattgcagct
tgcagagcaggggctcccttctctgtaattggaaacacaatcagccacataactcatcag
aatggttttcaagtctgtccacattttgtgggacatggaataggatcttactttcatgga
catccagaaatttggcatcatgcaaatgacaatgatctacccatggaggagggcatggca
ttcactatagagccaatcatcacggagggatcccctgaatttaaagtcctggaggatgca
tggactgtggtctccctagacaatcaaaggtcggcccagttcgagcacacggttctcatc
acgtcgaggggcgcgcagatcctgaccaaactaccccatgaggcctga

DBGET integrated database retrieval system